All Entries

Free On-line Dictionary of ComputingFORMPeano
AcknowledgementsFORMACPeano arithmetic
Missing definitionFORMALPEARL
!formal argumentPebble
"Formal Description TechniquePebbleman
#formal methodsPEBCAK
$Formal Object Role Modeling LanguagePEBKAC
$1formal reviewPECOS
%formatPedagogic Algorithmic Language
'FORMAT-FortranPEEK
+Formatting Output Specification InstancePEEL
,Formespeephole optimisation
/form factorpeephole optimization
0form feedpeer
0/1 knapsack problemform functionpeer-to-peer
1FORMLpeer-to-peer network
100BaseFXformsPegasus
100BaseTformulaPEIPA
100BaseTXFormula ALGOLPEM
100BaseVGForsythePENCIL
100VG-AnyLANFORTHpencil and paper
10base2for The Rest Of Thempenis war
10base5for The Rest Of UsPentium
10baseTForth Modification LabPentium 2
120 resetFortranPentium 3
1-2-3Fortran 66Pentium II
1394Fortran 77Pentium III
1541Fortran 90Pentium II Xeon
1581Fortran Automatic Symbol TranslatorPentium Pro
16000Fortran Dpeon
16450Fortran IPeopleSoft
16550Fortran IIPEP
16550AFortran IIIPepper
16650Fortran IVPEPsy
16750CFortran-LindaPER
16 bitFortran Mpercent
16-bit applicationFortran Matrix Abstraction Technique FortranPerceptional Adaptive Subband Coding
16C550Fortran-Plusperceptron
16C750FORTRANSITpercussive maintenance
16C850Fortran Vperf
1802Fortran VIperfect programmer syndrome
192.168.1.1FortrashPERFORM
1NFFORTRUNCIBLEperiod
1TBSfortune cookieperiodic group
1.TR.6forumperipheral
2for values ofPeripheral Component Interconnect
20-GATEforwardperipheral device
2780forward analysisPeripheral Technology Group
2B1Dforward chainingPerl
2B1Qforward compatibilityPerl5
2B+Dforward compatibleperl-byacc
2NFforward deltaPerl profiler
2.PAKforward engineeringpermanent link
32000Forward Error CorrectionPermanent Virtual Circuit
3270forwards compatibilityPermanent Virtual Connection
32-bit applicationforwards compatiblepermission
3780FORWISSpermutation
386For Your Information\perp
386BSDFOSIperplexity
386SPART.PARFOSILpersistence
386SXFOSSpersistent
3Com CorporationfossilPersistent Functional Language
3DNow!foundationpersistent memory
3DNow! ProfessionalFOundation for Research and Technology - HellasPersonal Communication Network
3DOfour-colour glossiesPersonal Communication Services
3GLfour colour map theorempersonal computer
3NFfour colour theoremPersonal Computer Memory Card International Association
3StationFourier transformPersonal Digital Assistant
3-tierfourth generation computerPersonal Identification Number
404fourth generation languagePersonalized Array Translator
4.2BSDfourth normal formperson of no account
431AFowler-Nordheim tunnellingperspective
4.3BSDFoxPERT
4510FoxBASE+pessimal
473L QueryFoxPROpessimising compiler
486Fox Softwarepeta-
486DXFox Wikipetabyte
486SXFPpetaflops
4GLFP2petdingo
4NFFPAPeter Chen
51forthfpcPetri net
56 kbpsFPGAPETSCII
56k lineFPLMTSPEX
586FPMpf
5ESSFP/MPFE
5NFFPM DRAMPFL
5th Glovefprintfpfm
6.001fpspForth
610FPUPfortran
6309FQDNPFP
64-bitFQLpg
6501frPGA
6502FRAPGA370
650xfractalPGP
6510fractal compressionPH
6526fractal dimensionpH
65816FRADph
6800fragilephacker
68000fragmentphage
68020fragmentationphase
68030FRAMphase alternating line
68040framePhase Encoded
68050frame bufferphase of the moon
68060Frame Check Sequencephase-shift keying
6809frame grabberphase space
680x0FrameKitphase-wrapping
686FrameMakerPHIGS
68HC11frame pointerPhilip R. Bagley
68LC040frame ratePhilips
6to4Frame RelayPhilips SCC68070
6x86Frame Relay Access Devicephilosophy
754frames per secondphishing
80186Frame Technology CorporationPHOCUS
80188frameworkPhoenix
80/20 ruleFramework 4phone mail
802.1framing specificationPhonetastic
802.11aFRANKPhong shading
802.11bFranz Lispphosphor fatigue
802.11gFrapsphoto CD
802.2Fraunhofer GesellschaftPhotoshop
802.3FREDPHP
80286fredPHP: Hypertext Preprocessor
8031Fredette's Operating System Interface Languagephreaking
80386frednetphysical
8048freephysical address
80486FreeBSDphysical addressing
8051FreeHEPphysical file
8052Freenetphysical layer
8080Free Objects for Crystallographyphysical memory
8086Free On-line Dictionaryphysical memory address
8088free open-source softwarePhysical Sequential
80x86FreePPPPhysical Transport Network
822freerexxPhysics Analysis Workbench
82430FXfree softwarePI
82430HXFree Software Foundationpi
82430MXfree variablePIC
82430VXfreewarepi-calculus
8250freezePick BASIC
8.3Frege, GottlobPICL
8450frequency division multiple accessPICNIC
8514frequency division multiplexingpico-
8514-AFrequency-Hopping Spread Spectrumpicosecond
88000Frequency ModulationPICS
88openFrequency Shift KeyingPICT
8-bit cleanfrequently asked questionPicTeX
8N1Frescopictogram
8 queens problemFreshpictograph
8 queens puzzlefriction feedPictorial Janus
8x86friedpicture
90-90 RuleFriendpicture element
9PACFRINGEPicture Quality Scale
:-)frinkPID
;friodepidgen+
<fritterwarePidgin
=FRLPIE
>FRMT-FTRNpif
?frobpiggybacking
??frobnicatepig, run like a
@frobnitzPIGUI
\Frobozz Magic Programming LanguagePIL
\{@}froggingPILE
A#FrolicPIL/I
A-0front endPILOT
a1front-end processorpilot error
A1 securityfront side busPilot European Image Processing Archive
A20 handlerfrotzedPIM
A-3frowneyPIN
A3DfryPINBOL
A4CFSPine
a56FSBpin feed
AACfsckping
AADLFSFping command
AALFSKping-flood
AAPFSLpinging
AAP DTDFSMping-pong
aardFSPPin Grid Array
AARPfsplitPink-Shirt Book
AARP probe packetsFTpin-out
AAUIFTAMPIO mode
A&BFTPPIP
abbrevFTP archivepipe
Abbreviated Test Language for Avionics SystemsFTP by mailpipeline
ABCFTP serverpipeline break
ABC ALGOLFTP Software, Inc.Pipeline Burst Cache
ABCL/1FTTPpipelined
ABCL/c+FTWPipelined Burst Cache
ABCL/RFTXpipeline stall
ABCL/R2FUBARpipelining
abductionFUDPIPEX Ltd.
ABENDfudgepiping
AberMUDfudge factorpiracy
ABIFudgetspirate
ABLEFUDGITPIRL
ABMFUD warspistol
ABNFFuel-canPIT
abortFuguePITA
ABPFujitsupixel
ABRfull-custompixels per inch
abscissafull-duplexpixmap
ABSETfull-duplex Switched Ethernetpizza box
absolute pathfull lazinessPJPEG
absolute pathnamefull-motion videopk
abstractfull outer joinPKE
abstract classfully associative cachePKI
abstract data typeFully Automated Compiling TechniquePKLITE
abstract interpretationfully lazy lambda liftingPKUNZIP
abstractionfully qualified domain namePKWARE, Inc.
abstract machinefumPKZIP
Abstract Machine NotationFunpl
abstract syntaxfunctionPL1
Abstract Syntax Notation 1functionalPL/1
abstract syntax treefunctional databasePL-11
Abstract-Type and Scheme-Definition Languagefunctional dependencyPL360
Abstract Windowing ToolkitfunctionalityPL516
Abstract Window Toolkitfunctional languagePL-6
ABSYSfunctional programPL.8
AC2functional programmingPla
AC3functional programming languagePLACE
ACAfunctional requirementsPLAGO
ACAPfunctional specificationplaid screen
Accelerated Graphics Portfunctional testingPLAIN
acceleratorfunctional unitplain ASCII
Accentfunction applicationPlain Old Documentation
acceptfunction completePlain Old Telephone Service
Acceptable Use PolicyFunction Graph LanguagePlain Old Telephone System
acceptance testingfunction inliningplain TeX
Acceptance, Test Or Launch Languagefunction keyplaintext
acceptorFunction Point AnalysisPLAN
Accessfunctor.plan
Access Control ListfunkyPlan 9
access methodFUNLOGPlanet
access permissionFunnelWebplan file
access pointfunny moneyPLANIT
access timefuriganaPlankalkül
ACCLAIMfurrfuPLANNER
Accounting FileFUSEPlanner-73
accounting managementFUSIONPLANS
Account Representativefusionplants
ACCUFutureBasicPLASMA
accumulatorfuture date testingPlastic Pin Grid Array
accuracyfutzplatform
ACEfuzzballPlatform for Internet Content Selection
ACFfuzzy computingPlatform Independent Graphical User Interface
ACF/NCPfuzzy logicplatinum-iridium
ACIAfuzzy subsetPlaton
ACIDfweepPLAY
ACISFWIWplay by electronic mail
ACKfxPlayground
ACLFX-87Play, Inc.
ACMFX-90playpen
ACMEFXOPlaystation
ACOMFXSplayte
acornFYAPLC
Acorn ArchimedesFYIPL/C
Acorn Computer GroupFYI4PL Cornell
Acorn Computers Ltd.GPLD
Acorn Online Media<g>plenum cable
Acorn RISC MachineG2pleonasm
ACOSG3plesiochronous
acoustic couplerG4Plesiochronous Digital Hierarchy
ACPGAPleuk grammar development system
ACPIgaPlexus
AcrobatGabrielPL/I
acronymgabrielPL/I-FORMAC
ACSEGabriel, Richardpling
ACTGADSplingnet
ACT++GaelicPLisp
Act1gagPL/I SUBSET
ACT 1GAIAPL/I Subset G
Act2GALPLITS
Act3GalaxyPLL
ActalkGalileoPL/M
ActisGambitPLMK
activation recordgamesplokta
active DBMSgame treeplonk
Active DirectoryGAMMAplotter
Active Language Igamma correctionPL/P
active matrix displayGAMSPL/PROPHET
Active Measurement ProjectgamutPL/S
Active MonitorGANPL/Seq
active objectGANDALFPL/SQL
Active Reconfiguring Messagegang bangPLTL
Active Server PagesGAPplug and play
ActiveXGAPLogplug and pray
ActiveX Data Objectsgarbageabetical orderPlug Compatible Manufacturer
ACT ONEgarbage collectPluggable Authentication Module
Actorgarbage collectionplugh
actorGarbage In, Garbage Outplug-in
ActorsGargoylePLUM
actor/singer/waiter/webmasterGarnetPlumber
ActraGARPplumbing
actual argumentgarplyPlural EuLisp
ActusGartner GroupPLUS
ADgasplus
adGASPPLUSS
Adagas plasma displayply
Ada++GATPM
Ada 83GATEpm
Ada 95gatepm2
Ada 9XgatedP-mail
ADABASGatesPMBX
Ada Core TechnologiesgatewayPMC
Ada/EdGateway 2000PML
AdalineGaussPMP
Ada LovelaceGaussian distributionpn
ADAMgawkpnambic
Adam7GBPNG
AdamakegenGbPNP
ADAMOgbPNU-Prolog
Adam Osborneg-bellPOA
Ada-OGBIPPoB
AdaplanGBMLPOC
AdaplexgbpsPOCAL
Ada Programming Support EnvironmentGCpocket calculator
ADAPTGCALpocket computer
Adaptable User InterfaceGCCpod
AdaptecGCLP.O.D.
adaptive answeringG-Codepodcast
Adaptive Communication EnvironmentGCOSPOE
Adaptive Digital Pulse Code ModulationGCOS Macro Assembler ProgramPOFAC
adaptive learningGCRPOFOD
adaptive routingGCTPOGO
Adaptive Server Enterprisegdpoint
Adaptive Simulated AnnealingGDApoint-and-drool interface
Adaptive TRansform Acoustic CodingGDBpoint-and-grunt interface
AdaptorGDBPSKpointed domain
Ada Semantic Interface SpecificationGödel, Kurtpointer
Ada Software RepositoryGDIpointer swizzling
ADCGDMOpointing device
ADCCPGDPLpointing stick
A/D converterGEPoint Of Contact
ADCUgepoint of presence
AD/CycleGE-645point of sale terminal
ADD 1 TO COBOL GIVING COBOLGEAPoint-to-Point Protocol
ADDDGEANTPoint-to-Point Protocol over ATM
additiveGECOMPoint-to-Point Protocol over Ethernet
addressGECOSPoint-to-Point Tunneling Protocol
address bookGedankenPoisson distribution
address busgedankenPOJO
addressed call modegeefpoke
addresseegeekPokémon exception handling
addressing modegeek outPolka
address maskGEIpoll
address resolutionGE Information Servicespolling
Address Resolution ProtocolGEMPoly
address spacegenpolygon pusher
Address Strobegender menderPOLYGOTH
ADELEGene Amdahlpolylithism
ADESGeneral Activities Simulation ProgramPoly/ML
ad hocGeneral Aerodynamic Simulation Programpolymorphic
ad-hockeryGeneral Dynamics Canada Ltdpolymorphic lambda-calculus
ad-hoc polymorphismGeneral Electricpolymorphism
AditiGeneral Electric Comprehensive Operating Systempolynomial
adjacencyGeneral Magicpolynomial-time
adjacentGeneral Packet Radio Servicepolynomial-time algorithm
ADLGeneral Protection Failurepolyvinyl chloride
AdLogGeneral Protection FaultPOM
ADMGeneral Public LicencePonder
ADMDGeneral Public LicensePong
adminGeneral Public VirusPOOL
Administration Management DomainGeneral Purpose Graphic LanguagePOOL2
administrative distanceGeneral Purpose Interface BusPOOL-I
Administrative DomainGeneral Purpose LanguagePooling Agreement for Technical Assistance
admissibleGeneral Purpose Macro-generatorPOOL-T
ADOGeneral Recursion TheoremPOP
Adobe Systems, Inc.generatePoP
Adobe Type Managergenerationpop
ADPCMGeneric Array LogicPOP++
ADRGeneric Expert System ToolPOP-1
ADSgeneric identifierPOP-10
ADSLgenericityPop-11
ADSPgeneric markupPOP-2
ADSUgeneric programmingPOP3
ADTGeneric Routing EncapsulationPOP-9X
Advanced Audio CodingGeneric Security Service Application Programming InterfacePOPART
Advanced Communication Function/Network Control Programgeneric thunkPOPCORN
Advanced Communications Functiongeneric type variablepop-down menu
Advanced Computing EnvironmentGenesiaPOPJ
Advanced Configuration and Power Interfacegenetic algorithmPoplar
Advanced Data Communications Control Protocolgenetic algorithmsPOPLER
Advanced Encryption Standardgenetic programmingPOPLOG
Advanced Function PresentationGEnie ServicesPOPLOG ML
Advanced Function PrintingGenken Programming LanguagePOP server
Advanced Intelligent TapeGENOVAPopTalk
Advanced Interactive eXecutivegensymPOR
Advanced Micro Devices, Inc.Gensym Corporationporn
Advanced Network Systems ArchitectureGensym Standard Interfaceporno
Advanced Peer-to-Peer NetworkingGentleman's Portable Coroutine Systempornography
Advanced Power ManagementGEN-Xport
Advanced Programmable Interrupt ControllerGeographical Information Systemportability
Advanced Program-to-Program CommunicationsGeographic Information Systemportable
Advanced Research Projects Agencygeometric meanPortable AIRTIME
Advanced Research Projects Agency NetworkGEORGEPortable Commodore 64
Advanced RevelationGEORGE 3Portable Common Loops
Advanced RISC Computing SpecificationGeorge BoolePortable Common Tool Environment
Advanced RISC MachineGeorg Simon Ohmportable computer
Advanced RISC Machines Ltd.GEOSPortable Document Format
Advanced SCSI Peripheral InterfaceGEPURSPortable Forth Environment
Advanced Software EnvironmentGeraldPortable Network Graphics
Advanced STatistical Analysis ProgramGerald SussmanPortable Object Adapter
Advanced Technology AttachmentGermanPortable Operating System Interface
Advanced Technology Attachment Interface with ExtensionsGESTPortable Pixmap
Advanced Video CodingGet a life!Portable Scheme Debugger
Advanced WavEffectGet a real computer!Portable Scheme Interpreter
Advantage Genget.comPortable Standard Lisp
ADVENTgettyPortable Tool Interface
Adventure Definition LanguagegfPort Address Translation
ADVSYSGFDLPORTAL
adwareg fileportal
AEGFLOPSporting
aeGFRPort Language
AEDGFSportmapper
AEGISghport number
AegisGHCPOS
Aeolusghetto codePOSE
AEPghostposet
aeroplane ruleGhostscriptpositional representation
AESghostviewPOSIX
AESOPGHzPOSIX Threads
afGIPOST
AFACgipost
AFAIKGibson, Williampostcardware
affine transformationgidposted write-through
affordanceGIFPostel, Jon
AFIPSGIF89postfix notation
AFJGIF89apostfix syntax
AFKGIFFPOSTGRES
aflexgigPostgreSQL
AFNORgiga-posting
AFPgigabitpostmaster
AFSgigabits per secondpost office problem
AFUUgigabytePost Office Protocol
aggigafloppost-order traversal
agentgigaflopsPOSTQUEL
aggregate typeGigaHertzPostScript
aggregationGIGOPostscript point
aggregatorgilleyPost, Telephone and Telegraph administration
AGLgillionPOSYBL
AGM Theory for Belief RevisionGilmore, Johnpotential difference
Agner Krarup ErlangGIM-1POTS
AGORAGINpound
AGPGINApound on
AGP graphicsGingerpound sign
A Hardware Programming LanguageGIPPOWER
AHDLGIPSPowerBuilder
AHPLGIRLpower cycle
AIGISpowerdomain
aiGiuseppe PeanoPowerFuL
AIAGIYFpower hit
AI-completeGKSPower Mac
AIDGKS-3DPower Macintosh
AIDAGLpower-on reset
AIDSglpower-on self-test
AIDXGlammarPowerOpen
AIFFglarkPowerOpen Association
AI InternationalGlasgow Haskell CompilerPowerOpen Environment
Aiken codeGLASSPowerPC
AI koanglassPowerPC 601
AIMACOglass box testingPowerPC G3
AimnetglassfetPowerPC Platform
AIRglass ttyPowerPC Reference Platform
AIr MAterial COmmand compilerGLBPowerpoint
airplane ruleglibcpower save mode
AITGlishpowerset
AIXGlispPowersoft Corporation
Ajaxglitchpower supply
AKCglobpower supply unit
AKCLglobal indexPP96
A. K. ErlangglobalisationPPC
AKLGlobal Network NavigatorPPCP
ALGlobal Positioning SystemPPD
alGlobal System for Mobile CommunicationsPPGA
Aladdin Enterprisesglorkppi
Aladdin Systems, Inc.GLOSPPL
ALADINGLOWPPLambda
ALAMGLSPPM
Alan F. ShugartGLUPPN
A-languagegluePPP
A Language Encouraging Program Hierarchyglue languagePPPoA
A Language for Attributed DefinitionsglyphPPPoE
A Language with an Extensible CompilerGlypnirP-Prolog
Alan KaygmPPTP
Alan M. TuringGMAPPQS
Alan ShugartGMDPR
Alan TuringGMD Toolbox for Compiler Constructionpr
ALARPGMTpr0n
A-lawgnPRA
ALCgnarlypragma
Alcool-90GnatPRAM
ALCORGNATSPraxis Critical Systems
AldatGNNpre\box
ALDESGNOMEPRE-CC
ALDiSPGnome ComputersPRECCX
ALECGNUprecedence
ALEFGNU archive siteprecedence lossage
ALEPHGNU assemblerprecharge
AlephGNU awkprecision
aleph 0GNU BCpredecessor
alertGNU Cpredicate calculus
AlexGNU C Librarypredicate logic
AlexisGNU DCpredict
ALFGNU Epredomain
AlflGNU Emacspre-emptive multitasking
algebraGNU Free Documentation Licenseprefetch
ALGEBRAICGNU General Public Licenseprefix
algebraicGNUMACSprefix notation
Algebraic Compiler and TranslatorGNU mirror siteprefix syntax
algebraic data typeGNU Network Object Model Environmentpre-order
Algebraic Interpretive DialogueGnuplotpre-order traversal
Algebraic Logic Functional languageGNU Privacy GuardPREP
Algebraic Manipulation PackageGNU Problem Report Management Systemprepaging
Algebraic Specification LanguageGNU public licenceprepend
algebraic structureGNUSpreprocessor
Algebra of Communicating ProcessesGNU sedpre-sales support rep
ALGOLGNU Smalltalkpresence detect
ALGOL 58GNUSteppresentation layer
ALGOL 60GNU superoptimiserPresentation Manager
ALGOL 60 ModifiedGoprestidigitization
ALGOL 60 RevisedgoalPRESTO
ALGOL 68goal seekPretty Amazing New Stuff
ALGOL 68CGo Back NPretty Good Privacy
ALGOL 68-Rgobblepretty pictures
ALGOL 68 RevisedGObject Introspectionprettyprint
ALGOL 68RSGodwin's Lawpretzel key
ALGOL 68SGodzillagrampreventive maintenance
ALGOL CGoedelPRI
ALGOL Dgo-faster stripesprimary cache
ALGOL NGoferPrimary Domain Controller
ALGOL WGoffinprimary key
ALGOL Xgo flatlineprimary management domain
ALGOL YGO-GOPrimary Rate Interface
algorithimgo goldprimary storage
algorithmGOLPrime Computer
ALgorithm DEScriptiongoldenPrimenet, Inc.
ALgorIthmic ASsembly languagegolf ball printerprime number theorem
Algorithmic LanguageGOMprime time
Algorithmic Modelgonkprimitive
Algorithmic Processor Description LanguagegonkulatorPrinceton University
Algorithmic Test Case GenerationGOODprincipal type
ALGYGood ThingPRINT
ALIASGoogleprinted circuit board
aliasgoogolprinter
aliasinggoogolplexPrinter Access Protocol
aliasing buggopherprinter port
AliceGopher clientprintf
alifeGopher object typePRINT I
A-LifeGopherspaceprinting discussion
ALJABRgoretsprint server
al-Khwarizmigorilla armPrint Services Facility
Allegrogo rootpriority inheritance
all-elbowsgorppriority interrupt
ALLIANCEGOSIPpriority inversion
allow-noneGosling, Jamespriority queue
ALLOYGOSMACSpriority scheduling
ALMGosperismPRISM
AlohaGOSPLPrisoner of Bill
Aloha Netgotchaprivacy
Alonzo ChurchgotoPrivacy Enhanced Mail
ALPGottlob Fregeprivate
ALPAKgovPrivate Automatic Branch eXchange
ALPHAgovernancePrivate Branch Exchange
AlphaGovernment OSI Profileprivate key
Alpha AXP 21164go voiceprivate-key cryptography
alpha/beta pruningGPPrivate Manual Branch eXchange
alphabetic languagegpprivileged instruction
alpha conversionGPFPRL
Alpha EV6GPIBPRMD
Alpha GeekGPLPRML
alphanumericGPMprobabilistic
alpha particleGPRSprobabilistic automaton
AlphardGPSProbability of Failure on Demand
alpha testingGPSSProbe
ALPSGPVproblem state
altGPXProblem Statement Language/Problem Statement Analyser
ALTACgqPROC
Altair 8800grprocedural
Alta VistaGRAALprocedural language
alt bitgrabber pointerProcedural Language/SQL
ALTERGrace Hopperprocedure
Alternating bit protocolGRAFproceedings
altmodeGraffitiprocess
ALTRANGRAILProcess and Experiment Automation Real-Time Language
alt.sourcesGRAINprocess data
ALUgrainProcess Design Language 2
Aluminum BookGRAMprocess ID
Alveygrammarprocess identifier
AMgrammar analysisprocessing
amgrammatical inferenceprocessor
AmandaGrandfather, Father, SonProcessor Direct Slot
A Manufacturing Languagegranularityprocessor farm
amateur packet radioGrapesProcessor System Modeling Language
AmberGrapevineprocessor time
AMBITgraphprocess scheduling
AMBIT/GGraph Algorithm and Software Packageprocess table
AMBIT/Lgraph coloringPROCOL
AMBIT/Sgraph colouringProcomm
AMBUSHGraphic ALGOLProcrustean string
AMDGraphical Kernel SystemProdigy
AMD 29000Graphical User InterfaceProDoc
AMD 29027Graphic Display Interfaceproduct
AmdahlGraphic Languageproduction system
Amdahl CorporationgraphicsProfessional Graphics Adapter
Amdahl's Lawgraphics acceleratorProfessional Office System
AMD Am2901graphics adapterprofessional programming
AMD Am2903graphics adaptorprofessional services
AMD Am2910graphics cardPROFILE
AMD K7Graphics Interchange Formatprofile
American National StandardGraphics Interface FormatPROFS
American National Standards InstituteGraphics Language Object SystemPROGENY
American Society of Mechanical Engineersgraphic workstationproglet
American Standard Code for Information InterchangeGraph-Oriented Object Databaseprogram
American Telephone and Telegraph, Inc.graph plotterProgram Composition Notation
American Wire Gaugegraph reductionprogram counter
America On-Line, Inc.graph rewriting systemProgram Design Language
America's Multimedia OnlineGRAPPLEProgram Evaluation and Review Technique
AMIGRASProgram Information File
AmigaGRASP/AdaProgrammable Airline Reservation System
Amiga EGRASPINProgrammable Array Logic
AminetgraultProgrammable Interrupt Controller
AMLGrayProgrammable Logic Controller
AML/Egraybar landProgrammable Read-Only Memory
AMOGray codeProgrammed Data Processor
Amoebagray-scalePROgrammed Graph REwriting Systems
AMP<gr&d>programmer
amperGREProgrammer Brain Damage
Amperegreater thanProgrammer's Cheer
ampersandgreatest common divisorProgrammers Hierarchical Interactive Graphics System
AMPLgreatest lower boundPROgrammer's Microapplication Language
AMPLEGreat RenamingProgrammer's Switch
Amplitude ModulationGreat Runesprogramming
amp offGreat Wormprogramming fluid
AMPPL-IIgreekprogramming language
AMPSgreekingProgramming Language/Cornell
AMSGreenProgramming Language/Systems
AMTRANGreen BookProgram Temporary Fix
AmuletGreen Book CD-ROMprogram transformation
angreen bytesPrograph
analoggreen cardPROGRES
analog computergreen lightningprogressive coding
Analog Hardware Design Languagegreen machineProgressive JPEG
analoguegreen monitorprogressive/sequential coding
analogue computerGreen's TheoremPROJECT
Analogy ModelGreenwich Mean Timeproject assurance
analytical CRMgreen wordsProject Athena
Analytical EngineGreg OlsonProject Guardian
Analytical MachineGregorian calendarprojection
Analytical Solutions Forumgrepprojective plane
anchorgrey-scaleProject MAC
ANCPGreystone Technologiesproject management
ANDGRGproject planning
ANDFGRIBProlog
Andorra-IgrickProlog++
Andorra Kernel LanguagegrilfProlog-2
Andorra-PrologGrim File ReaperProlog-D-Linda
Andrei MarkovGRINDProlog-II
Andrew File SystemgrindProlog-III
Andrew Fluegelmangrind crankProlog-Linda
Andrew Message SystemGRIPProlog/Mali
Andrew ProjectgripenetPROM
Andrew S. TanenbaumgritchPROMAL
Andrew TanenbaumgrixPrometheus
Andrew Toolkitgroffpromiscuous mode
Andy TanenbaumgrokPROM monitor
An Evolutionary System for On-line Programminggronkpron
AngelgronkedPronet
angle bracketgroupPronunciation
Anglo-Saxon pointGroup 3proof
angry fruit saladGroup 4PROOF/L
ANIGroup Code Recordingproof theory
Animated GIFgroup identifierpropeller head
animationGroup Separatorpropeller key
AnimusGroup-Sweeping Schedulingproportionally spaced font
ANLGroupwareProposal Writing
AnnaGroupwiseproposition
annealinggrovelpropositional calculus
annotategrungepropositional logic
ANNotated AdagryProposition of a Language Useable for Structured Specifications
annotationGSproprietary
annoybotgsPROSE
annoywareGSBLProSet
Annual Change TrafficGSIPROSPER
annulled branchGSLProspero
anonymous FTPGSMProTalk
ANother Tool for Language RecognitionGSPLprotected mode
ANRGSSPROTEUS
ANSGSS-APIprotocal
ANSAgtprotocol
ANSIgtgprotocol analyser
ANSI CGTK+protocol converter
ANSI Minimal BASICGTLProtocol Data Unit
ANSI/SPARCGT/SQLprotocol layer
ANSI/SPARC Architectureguprotocol stack
ANSI/SPARC modelguaranteed schedulingPROTON
ANSI X12guardProtosynthex
ANSI Z39.50Guarded Horn Clausesprototype
antenna gaingubbishPrototyper
Anthony Hoareguest bookprototyping
anti-aliasingGUIprovably difficult
antichainGUIDEprovably unsolvable
antisymmetricGuideprovider
antivirusGuide to Available Mathematical Softwareprovocative maintenance
antivirus programguiltwareprowler
antivirus softwaregunproxy
ANTLRgunchproxy ARP
ANUGunning Transceiver Logicproxy gateway
ANU MLgunzipProxy Server
any keyGupta Corporationproxy server
anytime algorithmgurflePS
aoguruPS1
AOCEguru meditationPS2
AOLGuy Lewis Steele, Jr.PS/2
AOPGuy SteelePS 440
AOSGVLPSA
APAgwPS-ALGOL
ApacheGW-AdapSather
Apache Software FoundationGW-BASICPSD
APALgweepPSDN
APARELGWHISpseudo
A PArse REquest LanguageGWMpseudocode
APCgypseudoprime
APDLGypsypseudorandom number
APEgzPseudoScheme
apEgzippseudosuit
APIhpseudo-tty
APICH.261PSF
APLH.264PSI
APL2H.323Psion
APLGOLHabitatPsion Organiser
APLWEBhackPSK
APMhackathonPSL
Apollo Computerhack attackPSL/PSA
apostrophehacked offPSML
apphacked upPSN
APPChackerPSO
AppKithacker ethicPSPP
APPLEhacker humourPSTN
Applehacking runPSU
Apple Address Resolution ProtocolHacking X for Ypsychedelicware
Apple Attachment Unit InterfaceHackintoshpsyton
Apple Computer, Inc.hackishpt
Apple IIhackishnessP-TAC
Apple Macintoshhackitudeptc
Apple Newtonhack modePTF
Apple Open Collaboration Environmenthack onPthreads
AppleScripthack togetherPTI
Applesoft BASIChack upPTN
applethack valuePtolemy
Appletalkha ha only seriousPTT
AppleTalk Data Stream ProtocolhairPUB
AppleTalk Filing Protocolhairypubic directory
apple-touch-iconhairy ballpublic domain
appletviewerHAKMEMpublic domain software
applicationhakspekpublic-key cryptography
Application Binary InterfaceHALPublic-Key Cryptography Standards
Application Configuration Access Protocolhalf-duplexpublic-key encryption
Application Control ArchitecturehalftonePublic Key Infrastructure
Application DeveloperHALGOLPublic Switched Telephone Network
application developmentHALMATpuff
application enablement servicesHal/SPUFFT
Application environment specificationHalt and Catch Firepull
Application Executivehalting problempull-down list
Application Integration ArchitectureHamiltonpull-down menu
application layerHamiltonian cyclepull media
application lifecycle managementHamiltonian pathPulse Code Modulation
Application Portability ArchitectureHamiltonian problempumpkin
application programHamiltonian tourpumpkineer
Application Program InterfaceHamilton's problempumpking
Application Programming Interfacehammerpunch card
Application Protocol Data UnitHamming codepunched card
Applications Development ManagerHamming distancepunt
application serverHamming, RichardPurdue Compiler-Construction Tool Set
Application Service ElementhamsterPurdue University
application service providerHan characterpure functional language
applications languageHANDpure lambda-calculus
application softwarehand cruftPureLink
Application Software Installation ServerHandelPure Lisp
Application-Specific Integrated Circuithand hackpurely functional language
Applications Programming InterfaceHand-held Personal ComputerPurify
applications softwarehandlePurple Book
application testinghandoffpurple wire
Application Visualisation SystemhandoverPurveyor
applicative languagehand-rollpush
Applicative Language for Digital Signal Processinghandshakepush-button
applicative order reductionhandshakingPush Down List
APPLOGhandwavepush media
APPNhangPVC
approximation algorithmhanjaPVM
April Fool's JokeHanoiPV-WAVE
A Programming LanguageHan Unificationpw
APSEhanziPWM
APThappilypy
APX IIIHappyPythagoras
aqhaptic interfacePythagoras's Theorem
AQLhapticsPythagoras' Theorem
arhaquePythagorean Theorem
arbitrary precision calculatorhard bootPython
ARChard-codedQ
archardcopyQA
Arcadehard crashqa
ArchBSDhard diskQA4
archiehard disk driveQAM
Archimedeshard driveQbasic
architecturehard linkQBE
Architecture Neutral Distribution Formathard linkingQCA
archivehard sectorQCIF
archive sitehardwareqdjanus
ARCnetHardware Abstraction LayerQDOS
ARCShardware circular bufferQEMM386
ArcticHardware Description LanguageQIC
arenahardware handshakingQL
AREShardware registerQlambda
AREVhardwarilyQLISP
AREXXhard-wiredQLOG
argHarris Semiconductor Ltd.QMQP
argumentHarvard architectureQMTP
ArgusHarvard GraphicsQMW
ArielHarvard Mark II MachineQ'NIAL
ARI ServiceHarvestQNX
ARITH-MATICHarvest CQoS
Arithmetic and Logic UnithashQPE
arithmetic meanhash bucketQSAM
arityhash characterQT-OBJECTS
arjhash codingQTRADER
Arjunahash collisionquad
ARLhash functionQuadralay Corporation
ARMhashingQuadrature Amplitude Modulation
ARM610hash tablequadruple bucky
ARM7Haskellquadruplex
ARM710Haskell BQuake
ARM7500Haskell CurryQualcomm
ARM8Haskell User's Gofer Systemquality
ARM800HASLquality assurance
ARM LtdHASPquality control
ARMMhas the X naturequality of service
armour-platedhatQuality Systems & Software Ltd.
ARPHayesquantifier
ARPAHayes-compatibleQuantify
ARPANETHazequantum
ARQHBOOKquantum bogodynamics
arrayhcquantum cell
array processorHC-900quantum cell wire
Array Processor Assembly LanguageHCFquantum computer
Array TheoryHCIquantum computing
arrow keyHCLPquantum dot
ARTHCPRVRQuantum-dot Cellular Automata
Artemis microkernelHCSquarter
ArtifexHDQuarter CIF
artificial intelligenceHD6309Quarter Inch Cartridge
Artificial Intelligence LabHDAQuay Financial Software
Artificial LifeHDCQUEASY
artificial neural networkHDDQueen Mary and Westfield College
Artisoft, Inc.HDFQueens Problem
Artistic licenseHDFLQueens Puzzle
ARTSPEAKHDLQueen's University
ASHDLCQUEL
asHDMquery
as31HDMIQuery By Example
AS400HDSLquery expansion
AS/400HDTVques
ASAhdxQuest
asapHead Disk Assemblyquestion mark
asbestosheaderqueue
asbestos cork awardHead Normal FormQueued Sequential Access Method
asbestos longjohnshead normalisation theoremQUICK
ascenderheads downquick-and-dirty
ASCIhead-strictQuickDraw
ASCIIheapQuick Mail Queueing Protocol
ASCII artheartbeatQuick Mail Transfer Protocol
ASCIIbetical orderheatseekerQuicksilver
ASCIIbonicsheat sinkQuicksort
ASCII character tableheat slugQuickTime
ASCII graphicsheavy metalquiesce
ASDIMPLheavyweightquiesce time
ASDLheavy wizardryQUIKSCRIPT
ASDO IMPlementation LanguageHebbian learningQUIKTRAN
ASEheisenbugQUIN
A* searchHelen Keller modequine
ASFHelixQuintec-Objects
ashhelloquintillion
Ashmedaihello packetQuintus Prolog
Ashton-Tate Corporationhello, sailor!quote chapter and verse
ASIChello, worldquotient
Asiliant TechnologiesHELPQu-Prolog
A Simulation Process-Oriented LanguageHelveticaQuty
ASIShenryquux
ASKHENSAqux
ASLHEPQWERTY
ASL+HEPDBQX
As Low As Reasonably PracticableHEPiXR2000
ASMHEPnetR2RS
ASMEHEPVMR3.99RS
ASNHEQSR3RS
ASN.1HERAR4RS
ASPHERAKLITrabbit job
ASPECThere documentRACE
ASpecTHerman Hollerithrace condition
aspectHermesRACF
aspect-oriented programmingHesiodRAD
aspect ratioheterogeneousRaddle
ASPENheterogeneous networkRadio-frequency identification
ASPIheterogenousRadio Frequency Interference
ASPIKheuristicradio in the loop
Aspirinheuristics testingradiosity
ASPLEHewlett-PackardRADIUS
ASPOLHewlett-Packard Graphics Languageradix
ASQCHewlett-Packard Interface BusRAID
ASRHewlett Packard Multi Processing ExecutiveRAIL
assemblerHewlett Packard Precision Architecturerainbow series
ASSEMBLYHewlett-Packard Visual Engineering Environmentrain dance
assembly codehexRAIS
Assembly LanguagehexadecimalRAISE
assembly languagehexidecimalRAISE Specification Language
Assembly Language CompilerhexitRAL
Assembly Language for MulticsHFCRAM
as sensible as a dictionaryHHCPRambus DRAM
assertionHHOJRambus, Inc.
ASSETHHOKRAMDAC
asset managementHHOSRAM disk
Asset Source for Software Engineering TechnologyhiRAM drive
assigned numbersHIBOLRAMIS II
assignmentHIDRAMTRON
assignment problemhidden flagrandom
Association Control Service Elementhierarchical databaserandom-access memory
Association for Computational LinguisticsHierarchical Data FormatRandom Access Memory Digital-to-Analog Converter
Association for ComputingHierarchical Design Methodologyrandomness
Association for Computing Machineryhierarchical file systemrandom number
Association for Progressive CommunicationsHierarchical Music Specification Languagerandom testing
Association for SIMULA Usershierarchical navigationrange
Association Française des Utilisateurs d'UnixHierarchical Object Oriented DesignRapid Application Development
Association of American Publishershierarchical routingRapidCAD
Association of C and C++ UsershierarchyRapidly Extensible Language, English
Association of Lisp UsersHiggs Bugsonrapid prototyping
associative arrayhigh bitRapidwrite
associative memoryHigh bit-rate Digital Subscriber LineRAPT
Associative Memory Parallel Processing Languagehigh colourRARE
associativityHigh-Definition Multimedia Interfacerare mode
ASThigh densityRARP
ASTAPHigher Education National Software ArchiveRAS
AST Computers, LLChigher-order functionRASP
asteriskhigher-order macroraster
asterixHigh-level Data Link Controlraster blaster
Astra Digital Radiohigh-level languageraster burn
Astralhigh memory arearaster font
AST Research, Inc.high mobyrastergram
asymmetrical modulationHigh Performance Computing and Communicationsraster graphics
Asymmetric Digital Subscriber LineHigh Performance File SystemRaster Image Processor
Asymmetric Digital Subscriber LoopHigh Performance Fortranrasterising
asynchronousHigh Performance Parallel Interfacerasterizing
Asynchronous Balanced ModeHigh Performance Routingraster subsystem
Asynchronous Communications Interface AdapterHigh Performance Serial BusRatatosk
asynchronous logicHigh Speed Circuit Switched Datarat belt
Asynchronous Transfer ModeHigh Speed ConnectRatC
asyncronousHigh-speed Net ConnectRATEL
AThigh speed serial interfaceRate monotonic scheduling
atHigh Voltage DifferentialRATFIV
AT-3HIGZRATFOR
ATAhill climbingrational
ATA-2HiLogRATional Fortran
ATA-4HIMEMRationalized C
Atanasoff-Berry ComputerHindenbugrave
Atanasoff, John Vincenthingrave on!
ATAPIHINTravioli code
ATA pointHiPACraw data
AtariHIPPIraw mode
Atari SThiraganaRAWOOP-SNAP
AT Attachmenthirsuteray casting
AT Attachment Packet InterfaceHISTORIANRayleigh distribution
AT bus architecturehistoryRay Tomlinson
AtFShitray tracing
AthenaHitachi 6309R:BASE
Atherton TechnologyHitachi HD64180RBASIC
AthlonHITLRBCSP
ATIShit rateRBOC
ATKhkrc
ATLASHL7RC4
Atlas AutocodeHLISPRCA 1802
ATMHLLRCA 1805
ATM ForumHLLAPIRCC
ATMPhlprc file
atobhmRCL
ATOLLHMArcp
atomicHMACRCS
A Tools Integration StandardhmakeRdb
ATRACHMPrdb
ATSHMSLRDBA
at signHMTLRDBMS
AT&ThnRDF
Attachment Unit InterfaceHNCRDI
AT&T Bell LabsHORDL
attenuationHoare powerdomainRDOS
atto-HobbitRDP
attoparsechobbitRDRAM
attributehogRDS
Attributed File SystemHOLRE
Attribute Translation SystemHOL-88re
ATXHOL-90read-eval-print loop
auholeREADME file
auberginehole modelRead-Only Memory
audioHollerithabetical orderread-only user
audiographicsHollerith, Hermanreal
audiographic teleconferencingHollywiredRealAudio
Audio IFFHOL-UNITYreal estate
AudioOneholy warsreal hack
Audio Processing Technologyhomereality check
Audio Video Interleavehome boxrealization
Augmented Backus-Naur Formhome keysReally Simple Syndication
AUIhome machinereal mode
A'UMhome pagereal number
AUPHome Phoneline Networking Alliancereal operating system
AuroraHomePNAReal Programmer
Austin Kyoto Common Lisphome row keysReal Programmers Don't Use Pascal
authenticationhomogeneousReal Simple Syndication
authoringhomogenousReal Soon Now
autobaudhomomorphismreal-time
autobogotiphobiaHoneywellReal-Time Common Design Language
AutoCADHoneywell-800 Business CompilerRealtime Disk Operating System
AutocodeHOODReal-Time Euclid
AUTOCODERHOOKReal-Time Mentat
autoconfhookReal-Time Object-Oriented Modeling
autoconfiscatehopReal-Time Operating System
Autodesk, Inc.HopeReal-Time Operating System Nucleus
AUTOEXEC.BATHope+Real-Time Pascal
AUTOGRAFHope+CReal Time Streaming Protocol
AUTOGRPHopfield modelreal-time structured analysis
Auto IdleHopfield networkReal-Time Transport Protocol
Autolisphorizontal applicationreal user
autoloaderhorizontal encodingReal Video
automagicallyhorizontal loop combinationReal World
automatahorizontal microcodereaper
automata theoryhorizontal scan ratereassembly
Automated Engineering Designhorizontal tabulationreboot
AUTOmated GRouPing systemHorn clauseREC
Automated Retroactive Minimal Moderationhoserecent changes
automated testinghosedrecipe
AUTOMATHHOS-STPLrecipient
Automatically Programmed ToolshostRecital
automatic baud rate detectionhost adaptorRECOL
automatic hyphenationHost Command FacilityRecommended Standard
Automatic Mathematical TRANslationHost Control Interfacerecord
Automatic Network Routinghost-host layerRecord Management Services
Automatic Number Identificationhostingrecords
Automatic Repeat RequesthostnameRecord Separator
Automatic Send Receivehost numberrectangle slinger
Automatic Sequence Controlled Calculatorhosts filerecurrence relation
automationHot Fixrecurse
Automatische RechenplanfertigungHotJavarecursion
automatonHotlinerecursion theory
Automatrix, Inc.Hotline Communications Ltd.recursive
Autonomous SystemHotline Connectrecursive acronym
Autonomous System Numberhotlinkrecursive definition
Autopasshotlistrecursive descent parser
autopilot codeHotmailRecursive Functional Algorithmic Language
autoprojectorhot spotRecursive Macro Actuated Generator
AUTO-PROMPTHot Standby Routing Protocolrecursive type
AutostatHot Swapable Routing ProtocolRed
autostereogramHot Swappable Routing ProtocolRed Book
A/UXhot swappingRed Brick Intelligent SQL
auxiliary storageHOTTRedcode
avhouse wizardredex
availabilityHouston Automatic Spooling ProgramRed Hat
Avalon/C++Howe, DenisRediLisp
Avalon/Common LISPhow many nibbles in a byteredirection
avatarHPredirector
AVChp2psRedNet Ltd.
average seek timeH/PCredocumentation
AverStarHPCCREDUCE
AVIHPcodeReduced Instruction Set Computer
AvonHPCode-Plusreduction
AVSHPFreduction strategy
awHPFSredundancy
AWEHP-GLRedundant Array of Independent Disks
AWGHP-GL/2Redundant Array of Independent Drives
awkHP-IBRedundant Array of Inexpensive Disks
AWTHPLRedundant Array of Inexpensive Servers
aXeHPLOTRedundant Arrays of Inexpensive Disks
AXIOMHP-MPEred wire
axiomHP-PAred zone
AXIOM*HPPIre-engineering
Axiomatic Architecture Description LanguageHPRre-entrant
axiomatic semanticsHP-SUXrefactoring
axiomatic set theoryHP-UXREFAL
Axiom of ChoiceHP VEEREF-ARF
Axiom of Comprehensionhqxreference
axiom schemahrreference counting
AXLEhrefreferential integrity
ayacchsreferentially transparent
AYTHSBreferential transparency
azHSCreferer
AZERTYHSCSDreferrer
BHSL-FXREFINE
bHSMRefined C
B-0HSRPRefined Fortran
B1FFHSSIreflexive
B1 securityHSVreflexive domain
B2BHTReflexive transitive closure
B2 securityhtRefLisp
B3 securityHTHrefresh
b4HTLMrefreshable braille display
baHTMLrefreshable display
BaanHTML+refresh rate
Babbagehtmlcommentbox.comrefuctoring
Babbage, CharlesHTTLrefutable
babbling errorHTTPregex
BABELHTTP/1.0regexp
BABTHTTP cookieRegina
Baby ATHTTPdregional network
BABYLONHTTP proxy serverregister
BACAICHTTPSregister allocation
BachmanHTTP serverregister assignment
Bachman Information Systemshuregister dancing
backbonehubregistered port
backbone cabalHubnetregister set
backbone sitehubsregister spilling
back doorhueRegister Transfer Language
back-endhue, saturation, brightnessregistry
Back End Generatorhue, saturation, valueregression
Back End Generator Languagehuffregression testing
backgammonHuffmanREG-SYMBOLIC
backgroundHuffman codeREGTRAL
backing storeHuffman codingregular expression
back linkHuffman encodingRegular Expression Converter
backoffHugh Loebnerregular graph
BackOfficeHUGOrehi
backplaneHUGSReid, Brian
backportHuman-Computer Interactionreify
back-propagationHuman-Computer Interfacere-image
back quoteHuman Interface Devicereincarnation, cycle of
backronymHuman Interface Technology Laboratoryreinvent the wheel
backside cachehumanist technologyrelation
backslashhummarelational algebra
backspacehumorrelational calculus
backtickhumourrelational database
backtrackinghungrelational database management system
backupHungarian Notationrelational data model
Backup Domain ControllerHungry Programmersrelational DBMS
backup pumpkinhungry puppyrelational language
backup rotationHungry ViewKitrelational model
backup softwarehungusRELATIVE
Backus-Naur FormHunt the Wumpusrelatively prime
Backus Normal FormHurdrelative pathname
backward analysisHVDRelative Record Data Set
backward chainingHybridRELCODE
backward combatabilityHybrid Fiber Coaxrelease
backward compatibilityhybrid multiprocessingreleased version
backward compatiblehybrid testingREL English
backwards compatibilityhydra coderelevance
backwards compatiblehydrofluorocarbonreliability
BADHyperBaseReliability, Availability, Serviceability
Bad command or file nameHyper-Creliable communication
Bad ThingHyperCardReliable Data Protocol
bag on the sidehypercubereligion of CHI
baklava codeHyperionreligious issues
BALhyperlinkREM
balanced computingHyper-Manremailer
balanced treehypermediaRemote Access Services
BALGOLHyperNeWSRemote Database Access
BALITACHyperscriptRemote Desktop Protocol
BALMhyperspaceremote echo
balunHyperSPARCRemote Job Entry
bamfHyperstrictremote login
Banach algebraHyperTalkRemote Method Invocation
Banach inverse mapping theoremhypertextremote monitoring
Banach spacehypertext linkRemote Operations Service Element
Banach-Tarski paradoxHypertext Markup LanguageRemote Procedure Call
banana labelHypertext Transfer ProtocolRemote Reference Layer
banana phenomenonHyperText Transmission Protocol, SecureRemote Spooling Communication Subsystem
banana problemhyperwareRemote Write Protocol
bandwidthhypotenuseremovable disk
banghysterical reasonsremovable hard disk
bang onHytelnetrendering
bang pathHyTimeRenderMan Shading Language
banneri18nrendezvous
BanyanI2OREP
BAPi386repeat
BAPIi486repeater
bari487repeating group
Barbara Liskovi860repeat loop
bar codeIArepetitive strain disorder
bare metalIA32repetitive strain injury
barfIABREPL
barfmailIADreplacement algorithm
barfulationIALReplay
barfulousIAMreplication
barnacle codeIANAreplicator
barneyIANALreply
BaroqueIAPRepondez s'il vous plait
baroqueI-APLReport Program Generator
barrel shifterIARrepository
barycentricIASRepresentation Language Language
baseIAWRequest For Comments
base 64IAYSDAHrequest for proposal
basebandIBEXRequest For Technology
base classIBMRequired-COBOL
baselineIBM 1130requirements
base memoryIBM 1403Requirements Acquisition and Controlled Evolution
basenameIBM 1620requirements analysis
Base TechnologyIBM 1710Requirements Engineering
bashIBM 2741Research Systems, Inc.
BASICIBM 3270ResEdit
Basic Assembly LanguageIBM 360reserved memory
BASIC AUTOCODERIBM 370resolution
Basic COBOLIBM 370ESAresolver
Basic Encoding RulesIBM 370XAResource Access Control Facility
Basic FortranIBM 3720Resource Description Framework
Basic Input/Output SystemIBM390resource fork
Basic JOVIALIBM 650Resource Reservation Protocol
Basic Language for Implementation of System SoftwareIBM 700 seriesRestricted EPL
Basic Multilingual PlaneIBM 701restriction
Basic Object AdapterIBM 704Restructured EXtended eXecutor
Basic Object SystemIBM 7040restructuring
Basic Operating SystemIBM 705retcon
Basic Programming SupportIBM 709rete
Basic Rate InterfaceIBM 7090RETI
Basic Service SetIBM 7094Retrieve
BASIC VIBM 801retrocomputing
Bastard Operator From HellIBM compatibleretronym
bastion hostIBM Customer Engineerreturn from interrupt
batchIBM discountreturn from the dead
batch fileIBM PCReturn To Zero
batch processingIBM PC ATreusability
bathtub curveIBM PCjrreuse
baudIBM PC XTReverse Address Resolution Protocol
baud barfIBM System/36Reverse ARP
BaudotIBM Systems Engineerreverse engineering
Baudotbetical orderIBM zSeriesReverse Polish Notation
Baudot codeIbpag2reverse polish syntax
baud rateIburgRevised ALGOL 60
bawkICrevision
bayICARevision Control System
bazICAMRevolutionary Surrealist Vandal Party
bbICANNrevolutions per minute
BBCI-CASEREX
BBC MicroICBM addressREXX
BBC MicrocomputerICEREXXWARE
BBC Networking ClubicebreakerRF
BBLICESRFC
BBN ButterflyICETRANRFC 1014
BBN TechnologiesICIRFC 1034
bboardICLRFC 1035
BBSICMPRFC 1057
BCICMP Router Discovery ProtocolRFC 1058
BCBFI-CommRFC 1081
BCCiCOMPRFC 1094
BCDIconRFC 1112
BCLiconRFC 1119
BC NELIACIcon-Based Parser Generation System 2RFC 1123
BCNUIconicodeRFC 1156
BCPLICONIX Software Engineering, Inc.RFC 1157
BCSIC-PrologRFC 1171
bdIC Prolog IIRFC 1208
BDCICQRFC 1213
BDLICSIRFC 1267
BDPAICTRFC 1268
beICWRFC 1304
BEAICWSRFC 1321
beamIdRFC 1334
beameridRFC 1341
beam searchI-DRFC 1347
beanID10TRFC 1350
beanie keyIDAMSRFC 1388
bearer channelIDDRFC 1436
bear pawIDERFC 1441
Beats the shit outa meIDEARFC 1442
BeboIDEALRFC 1443
BeBOPidealRFC 1444
BeBoxIdealized CSPRFC 1445
BEDOIdealized Instruction SetRFC 1446
BedrockIDEFRFC 1447
beepIDEF0RFC 1448
beeperidempotentRFC 1449
BEGidentifierRFC 1450
@BeginideogramRFC 1451
\begin{IDF}RFC 1452
BEGLI didn't change anything!RFC 1475
beige toasteridkRFC 1508
Be IncIDLRFC 1509
BELIDMSRFC 1520
belief revisionIDMSXRFC 1521
BELLId NouveauRFC 1526
BellIDOLRFC 1531
bellIDS/IRFC 1550
Bell 103IDSNRFC 1561
Bell Communications Research, Incid SoftwareRFC 1568
BellcoreIDSSRFC 1591
bell curveIERFC 1630
Bell LaboratoriesieRFC 1661
Bell LabsIECRFC 1700
bells and whistlesIEC 559RFC 1701
bells, whistles, and gongsIEEERFC 1702
benchmarkIEEE 1076RFC 1707
Bend Over, Here It Comes AgainIEEE 1394RFC 1730
Benoit B. MandelbrotIEEE 488RFC 1756
Benoit MandelbrotIEEE 754RFC 1760
Bentley Systems, Inc.IEEE 802RFC 1777
BeOSIEEE 802.1RFC 1778
BERIEEE 802.2RFC 1795
BerkeleyIEEE 802.3RFC 1823
Berkeley 4.2IEEE 802.3uRFC 1825
Berkeley EDIF200IEEE 802.3zRFC 1831
Berkeley FPIEEE 802.4RFC 1861
Berkeley Internet Name DomainIEEE 802.5RFC 1938
Berkeley LogoIEEE Computer SocietyRFC 1951
Berkeley NetworkIEEE Floating Point StandardRFC 1959
Berkeley Quality SoftwareIEEE Standard 1149.1RFC 1960
Berkeley Software Design, IncIEFRFC 2045
Berkeley Software DistributionIENRFC 2046
Berkeley SoftworksIEPGRFC 2047
Berkeley UnixIESGRFC 2048
Berkeley YaccIETFRFC 2049
berklixIF1RFC 2060
Berners-Lee, TimIF2RFC 2061
Bernoulli BoxIFACRFC 2068
Bernoulli principleIFCRFC 2093
Bernstein conditionifdef outRFC 2131
BERRIFDLRFC 2234
BertrandIFFRFC 2236
Bertrand MeyeriffRFC 2246
Bertrand RussellIFIPRFC 2279
BerzerkeleyIFPRFC 2281
BerzerkleyIFSRFC 2298
bespokeIFXRFC 2326
best effortIf you want X, you know where to find it.RFC 2364
best first searchIGCRFC 2408
Best FitIGESRFC 2516
BETAIGLRFC 2543
betaIGMPRFC 2795
beta abstractionIGPRFC 2821
beta conversionIGPLRFC 3232
BetamaxedIGSRFC 4213
beta reductionIGURFC 792
beta testIHSRFC 821
beta testingIHVRFC 822
beta versionIIcxRFC 826
BezierIIDMS/RRFC 854
Bezier curveIILRFC 903
Bezier surfaceIINRENRFC 908
bfIIOPRFC 959
BFIIIRRFCOMM
bgIIRCRFE
BGAIISRFI
bghIITRFID
BGPIITFRFP
bhIITRANRFT
BHC CodeilRG58
biILBMRG8
bibILFRGB
bibleILIADRhapsody
BIBOPI-Linkribbon cable
BibTeXILISPrib site
BiCapitalisationill-behavedrice box
BiCMOSILLIACRichard Gabriel
bidirectional printingIlliac IVRichard Hamming
Bidouilleurs Sans ArgentIllinois Functional ProgrammingRichard Korf
bi-endianILOCRichard P. Feynman
BIFFIlog SolverRichard P. Gabriel
biffiMacRichard Stallman
\bigimagerich object
Big bag of pagesimage formatsRich Site Summary
big blueimage mapRich Text Format
big-endianimage processingRIFF
Big Gray Wallimage recognitionRIGAL
big ironimagingRigel
BIG-LANImago Europe plcright brace
BiglooImago On-lineright bracket
bignumimakeright-click
bigotIMAOright join
Big Red SwitchIMAPright outer join
Big Roomimcright parenthesis
big winIMDRight Thing
bijectionIMHORijndael
Bill GatesIMLring network
Bill Joyimmediate versionring topology
binariesImminent Death Of The Net Predicted!Riordan's Internet Privacy Enhanced Mail
binaryIMNSHORIP
binary coded decimalIMOrip
Binary Compatibility StandardIMPripcording
binary counterimpact printerRIPE
binary dataimpedanceRIPEM
binary exponential backoffimperativeripper
binary fileimperative languageRISC
binary large objectimperative programmingRISCiX
binary packageImperial College of Science, Technology and MedicineRISC OS
binary prefixImperial Software TechnologyRiscPC
binary searchIMPlementation languageRISC System/6000
Binary Synchronous TransmissionimplicationRisk Based Testing
binary treeimplicit parallelismRISQL
BINDimplicit type conversionRITL
binderyimpliesRJ-11
binding handleimplyRJ-45
binding-time analysisimportRJE
BinHeximprecise probabilityRKM
Binhex 4.0IMProved Mercury autocodeRL
BinPrologIMRrl
bioinformaticsIMSRLaB
BioMeDical PackageIMS 6100RLDRAM
biometric deviceImsaiRLE
biometricsIMS/Data BaseRLF
BIORIMS/Data CommunicationsRLL
BIOSIMSErlogin
BIPIMTCRMAG
bipartite graphinRMAIL
BIPMIna JoRMI
bipolarInARPRM-ODP
bipolar transistorin-band signalingRMON
BIPSin-band signallingRMS
Bird-Meertens FormalismincRNF
Birds Of a Featherincantationro
BISDNincluderoach
Bisoninclude warROADS
Bison++inclusiveRobert T. Morris
BISTincomparableROBEX
bisyncincremental analysisRoboHELP
bitincremental backuprobot
bit bangincremental constraint solverrobot exclusion standard
bit bashingIncremental Prototyping Technology for Embedded Realtime Systemsrobots.txt
bitblt[incr Tcl]robust
bit bucketindentRockwell Protocol Interface
bit decayindentationRocky Mountain Basic
bit diddlingindent stylerococo
biteIndependent Computing ArchitectureROCOF
Bit Error RateIndependent Logical Fileroff
bit fieldIndependent Verification and ValidationROFL
bitmapindexROFLMAO
bitmap displayIndex Datarogue
bitmap fontIndexed Sequential Access Methodrollback
bitmapped displayindex.htmROM
bit maskindex.htmlROM BIOS
BITNETindex registerROME
bitonal imageindicesRom Kernel Manual
bit-paired keyboardindirect addressroom
bit patternindirect addressingROOM Methodology
bit planeindirectionroom-temperature IQ
bit rateindirect jumproot
bit-robbinginductionroot bridge
bit rotinductive inferenceroot directory
bit sliceinductive relationroot mode
bits per inchIndustrial Programming, Inc.root node
bits per pixelIndustrial Robot LanguageRoot Normal Form
bits per secondIndustry Standard Architectureroot version
bit stringinetdROSE
bit stuffinginewsRosette
BitTorrentinfant mortalityRoskind grammars
bit twiddlinginfeasible pathrot13
bitty boxinferencerotary debugger
bitwiseinference enginerotational latency
bitwise complementinference rulerotations per minute
bixieinfimumROTFL
biz-core stabilityinfiniteROTFLMAO
bjInfinite Impulse ResponseROTFLMAOASTC
Bjarne Stroustrupinfinite loopROTFLOL
BJC4000Infinite Monkey Theoremround-robin
black artinfinite setround tape
black boxinfinityround-trip time
black-box testinginfix notationroute
Black Data Processing Associatesinfix syntaxrouted
black holeinflateroute flapping
BlackIceINFNrouteing
black magicInfobahnrouteing domain
blarghInfo BASICrouter
blastinfobotroutine
blatInformatics Corporationrouting
BLAZEinformationRouting Information Protocol
BLAZE 2Information Algebrarouting policy
bleamInformation and Communication TechnologyRouting Table Maintenance Protocol
bleeperInformation Appliancerow
bletcherousInformation BuildersRow Address Strobe
Bletchley ParkInformation Engineering Facilityrow-level locking
Blind Carbon Copyinformation highwayRoyal Veterinary and Agricultural University
B-LINEInformation Infrastructure Task ForceRPC
blinkenlightsInformation InnovationRPG
BLISSinformation islandRPG-II
BLISS-10Information ManagementRPI
BLISS-11Information Management SystemRPL
BLISS-16Cinformation overloadRPL-1
BLISS-32Information Processing LanguageRPM
BLISS-36Information Resource Managementrpm
blitinformation superhighwayRPN
blitterInformation Systems FactoryRépondez s'il vous plait
blivetinformation technologyRPT
bloatinformation technology governanceRRL
bloatwareInformation Technology Infrastructure LibraryRRS
BLOBInformixRS
blockInfoSeekRS-232
Block And List ManipulationInfoStreet, Inc.RS-232C
Block Diagram CompilerinfotainmentRS-232D
blocked recordsInfoWord OfficeRS-422
Block Redundancy CheckinfraredRS-423
Block Started by SymbolInfrared Data AssociationRS-449
block-structuredinfrastructureRS-485
block transfer computationsInglishRS6000
blogINGRESRS/6000
blog-driven developmentinheritanceRS6K
Bloggs Family, theinitgameRSA
BloombuginitialiseRSA Data Security, Inc.
BlosimInitial Microprogram LoadRSA encryption
blow an EPROMInitial Operational Test and EvaluationRSCS
blow awayInitial Program LoadRéseaux Associés pour la Recherche Européenne
blowing your bufferInitial Program LoaderRéseaux IP Européens
blow outinitiatorRS flip-flop
blow pastinjectionrsh
blow upinkjet printerRSI
BLOXink printerRSL
BLTinlineRSN
Blueinline elementRSS
Blue Bookinline imageRSS feed
Blue BoxINMOS transputerrstat
blue dot syndromeinner classRSTS/E
Blue Glueinner joinRSVP
Blue Screen of Deathinner productRT-11
Blue Screen of LifeInnovAdaRTBM
Blue Sky SoftwareinodeRTC++
Bluetoothin-order traversalRT-CDL
blue wireinoutRTEE
blurgleIN pointRTF
bmInprise CorporationRTFAQ
BMANInputRTFB
BMASFinputRTFM
BMDPinput deviceRTFS
B-Methodinput/outputRTI
BMFinput/output redirectionRTL
BMPinquiry/response systemRTL/1
bmpINRIARTL/2
BMWFinsanely greatRTM
bninsertion sortRTMP
BNCINSIGHTRTOS
BNFInsignia Solutions, Inc.RTP
BNR PascalinspectionRT-PC
BNR Prologinstallable file systemRTS
boinstalled user baseRTSA
BOAinstallerRTSP
boainstanceRTT
boardinstance variableRTTI
boat anchorinstantiateRTTY
Bobinstantiationru
Bobo the WebmonkeyInstitute for Global Communicationsrubi
BOCSInstitute of Electrical and Electronics Engineers, Inc.Ruby
Boehm B.Institut National de Recherche en Informatique et Automatiquerude
BOEINGinstructionRUFL
BOFInstruction Address Registerrun
BOFHinstructional technologyRUNCIBLE
bogometerinstruction mnemonicrunes
BogoMipsinstruction prefetchrunic
bogoninstruction schedulingrun-length encoding
bogon filterinstruction setRun Length Limited
bogon fluxinstruction set architecturerun time
bogosityInstruction Set Processorrun-time environment
bogo-sortinstrumentrun-time error
bogotifyintrun-time library
bogue outINTCODErun-time support
BOHICAintegerrun-time system
Bohr bugInteger SPECbaserateRun-Time Type Information
boinkInteger SPECbaseratioruptime
BOLEROInteger SPECrateRUSH
Bolt, Beranek and Newman, Inc.Integer SPECratioRussell
bombintegrated circuitRussell, Bertrand
bonIntegrated Database Management SystemRussell's Attic
bondage-and-discipline languageintegrated development environmentRussell's Paradox
bonk/oifIntegrated Drive Electronicsrusty iron
Booch methodIntegrated Information Technologyrusty memory
bookIntegrated Modelling Support EnvironmentRUTH
bookmarkIntegrated Project Support Environmentrw
BookreaderIntegrated Services Digital Networkrwho
book titlesIntegrated Systems ArchitectureRWP
BookviewerIntegrated Systems LaboratoryRx
boolintegrationRYFM
Booleanintegration testingS
Boolean algebraintegritys///
Boolean logicintegrity constraintS3
Boolean searchIntelSA
Boole, GeorgeIntel 4004sa
BoosterIntel 4040SA-110
bootIntel 486SAA
boot blockIntel 486DXSaber-C
boot diskIntel 486SXSaber-C++
bootingIntel 487SXSAC
BOOTPIntel 8008SAC-1
bootstrapIntel 80186SAC2
bootstrap loaderIntel 80188sacadm
boot virusIntel 80286sacred
Border Gateway ProtocolIntel 80386SAD
borfIntel 80386DXSAD SAM
Borland International, Inc.Intel 80386SXSADT
Borland Software CorporationIntel 8048SAFARI
BOSIntel 80486safe
Bose-Chaudhuri-Hocquenghem CodeIntel 8051safe mode
BOSSIntel 8080safety
botIntel 8085safety-critical system
botmasterIntel 8086saga
bottomIntel 8088sagan
BottomFeederIntel 80x86SAGE
bottom feederIntel 8751SAIC
bottom-uniqueIntel Comparative Microprocessor Performance indexSAID
bottom-up implementationIntel CorporationSAIL
bottom-up modelIntelDX4SAINT
bottom-up testingIntel i960Saint Andrews Static Language
botwarINTELLECTSAL
bounceintellectual propertySALEM
bounce messageintelligent backtrackingSales Automation
boundary scanintelligent databasesalescritter
boundary valueIntelligent Input/OutputSales Force Automation
boundary value analysisIntelligent I/OS-ALGOL
boundedintelligent keySALT
boundedly completeintelligent terminalsalt
bound variableIntelliMousesalt mines
bournebasicIntel Literature Salessalt substrate
Bourne shellIntelsatSAM
boustrophedonicIntel x86sam
boxintensionalSAM76
boxed commentsIntent to PackageSamba
boxenINTERACTIVESAME
Boxerinteractivesame-day service
boxologyInteractive CourseWareSAMeDL
Boycott AppleInteractive Data analysis Languagesamizdat
bozoticInteractive Data Entry/AccessSAML
BPELInteractive Data LanguageSammet, Jean E.
BPIinteractive development environmentsample
bpmakeInteractive Development Environmentssample rate
bppInteractive Software Engineeringsampling
BPRInteractive System Productivity Facilitysampling frequency
BPSInteractive Voice Responsesamurai
bpsInteragency Interim National Research and Education NetworkSAN
BQSInterBasesandbender
brINTERCALsandbox
braceInterchange File FormatSandman
bracketINTERCOMSan Francisco
bracket abstractionInterdatasanity check
brailleInterest Group in Pure and Applied LogicsSanta Cruz Operation
braille displayinterestingSAP
Braille embosserinter-exchange carrierSAP AG
Braille printerinterfaceSAPI
Brain Aid Prologinterface analysisSAR
brain-damagedInterface ArchitectSAS
brain-deadInterface Definition LanguageSASD
brain dumpInterface Description LanguageSASE
brain fartInterface Message ProcessorSASI
BrainfuckInterior Gateway ProtocolSASL
brainointerlaceSASL+LV
branchinterlaced imageSASL-YACC
Branch and HanginterlacingSAS System
branch coverage testingInterlanSATA
branch delay slotInterleafSATAN
Branch on Chip Box FullinterleaveSather
branch predictioninterleavingSather-K
Branch Target BufferINTERLINKsatisfiability problem
branch to FishkillInterlispsaturation
BrazilInterlisp-10Saturday-night special
BRBInterlisp-Dsausage code
breadcrumbsIntermediaSAVE
breadth-first searchIntermedia Interchange Formatsave
breakintermediate codesave as
break-even pointIntermediate Distribution Framesay
breakpointIntermediate Programming Languagesb
break statementIntermediate SystemSB AWE32
breath-of-life packetIntermediate System-Intermediate SystemSBCS
breedleintermercialSBD
BRHIntermetrics, Inc.SBE
BRIintermodulation distortionSBM
Brian Reidinternal field separatorsSB-Prolog
BRIDGEInternal TranslatorSBR
bridgeInternational Algebraic LanguageSBus
BridgetalkInternational Atomic TimeSC
briefcaseInternational Business Machinessc
brightnessInternational Computers Limited plcSCA
BrilliantInternational Core War SocietySCADA
bring X to its kneesInternational Data Encryption Algorithmscag
British Broadcasting CorporationInternational Electrotechnical Commissionscalability
British Library MethodInternational Federation for Information ProcessingScalable Coherent Interface
British Standards InstituteInternational Function Point Users GroupScalable Processor ARChitecture
British TelecominternationalisationScalable Sampling Rate
British Telecom Research LaboratoriesinternationalizationScalable Vector Graphics
brittleInternational Multimedia Teleconferencing Consortiumscalar
broadbandInternational Olympiad in InformaticsSCALLOP
broadcastInternational Organisation for StandardisationSCAN
broadcast quality videoInternational Organization for Standardizationscan
broadcast stormInternational Phonetic Alphabetscan design
BroadwayInternational Programmable Airline Reservation SystemSCANDISK
brochurewareInternational Smalltalk AssociationScan-EDF
brokenInternational Standardscanf
broken arrowInternational Telecommunications UnionScan-In, Scan-Out
brokerInternational Traffic in Arms Regulationscan line
broketInternautscanner
brontobyteInternetscanno
Brooks's Lawinternetscan path
brouterInternet Access Providerscan register
Brouwer Fixed-Point TheoremInternet Adapterscar tissue code
Brown and Sharpe Wire GaugeInternet addressSCC
brown paper bag buginternet addressSCCS
browserInternet Architecture BoardSCEPTRE
browserconfig.xmlInternet Assigned Numbers AuthoritySchachter's Hypothesis
BRSInternet backbonescheduler
BRUINInternet Chess Serverscheduling
brute forceInternet Control Message ProtocolScheduling API
brute force and ignoranceInternet Corporation for Assigned Names and NumbersScheduling Application Programming Interface
brute force attackInternet-DraftSchelog
BSInternet Engineering and Planning Groupschema
bsInternet Engineering Steering GroupSchema Definition Set
BS2000Internet Engineering Task ForceSchema Representation language
BSAInternet Experiment Noteschematic capture
BSDInternet Explorerschematic type variable
BSD386Internet ExpressSchematik
BSDIInternet Foundation ClassesScheme
BSD/OSInternet Go ServerScheme84
BSD UnixInternet Group Management ProtocolScheme88
BSIInternet Information ServerScheme->C
BSLInternet Inter-ORB ProtocolScheme Library
BSODInternet Message Access ProtocolScheme-Linda
BSOLInternet Monthly ReportScheme Object System
BSOMInternet Network Information CenterScheme Repository
BSP methodinternet numberScheme-to-C
BSRAMInternet Open Trading ProtocolSchlaer-Mellor
BSSInternet ProtocolSchoonschip
BSS segmentInternet Protocol Control Protocolschrödinbug
BSTInternet Protocol version 4SCI
btInternet Protocol version 6Science and Engineering Research Council
BTBInternet providerScientific Data Systems
btoaInternet Public LibrarySCL
B-ToolkitInternet RegistrySCM
BTOSInternet Relay ChatSC/MP
B-treeInternet Research Steering GroupSCO
BTRIEVEInternet Research Task ForceScode
BTRIEVE Technologies, Inc.Internet Security Association and Key Management ProtocolSCOOP
BTRLInternet Server Application Programming InterfaceSCOOPS
BTSInternet Service ProviderSCOPE
BTWInternet Societyscope
BUAFInternet TelephonyScorpion
BUAGInternet Telephony Service ProvidersScott-closed
bubble memoryinternetworkingScott domain
bubble sortInternetwork Packet eXchangeSCPI
bucky bitsInternet WormSCPI Consortium
bufferInternex On-Linescram switch
buffered write-throughInterNICSCRAP
buffer overflowinteroperabilityscratch
buffer overruninteroperable databasescratch disk
buginter-packet gapscratch monkey
bug-compatibleinterpolationScratchpad I
bug fixInterpressScratchpad II
bug fix releaseinterpretedscream and die
BugfootinterpreterScreamer
bug-for-bug compatibleInterpretive Menu Processorscreaming tty
buglixInter-process Communicationscreen
bugsinterruptscreen blanker
BUGSYSinterrupt handlerscreen dump
bug tracking systeminterrupt listScreen Peace
Bugzillainterrupt priority levelscreen popping
buildinterrupt requestscreen reader
built-ininterruptsscreen refresh
Built-in Self TestIntersil 6100screen saver
BullIntersil 6120screen scraper
bulletin boardinterstitialscreen server
bulletin board systemIntertecscreen sharing
bulletproofinteruptScreenwrite
Bull Information SystemsInterViewsscrew
buminterworkingscrewage
bumpintranetscribble
burbleIntrinsicsScribe
Bureau International des Poids et MesuresintrospectionSCRIPT
Burge's Languageintrospection annotationscript
buried treasureIntrusion Countermeasure ElectronicsScriptics
burn-inIntrusive Testingscripting language
burn-in periodIntuitionscrog
Burroughs CorporationintuitionismSCROLL
Burst EDOintuitionistic logicscroll
Burst Extended Data Out DRAMintuitionistic probabilityscrollable list
burst pageintuitionist logicscroll bar
Burst Static Random Access Memoryinvariantscrolling
businversescrool
bus errorInverse Address Resolution Protocolscrozzle
Bush, Vannevarinverse comment conventionscruffies
Business Analystinverted indexSCSI
Business Application Programming Interfaceinvoking a methodSCSI-1
Business Process Re-engineeringInWorld VRSCSI-2
Business Software AllianceIOSCSI-3
Business Systems AnalystioSCSI adaptor
business to businessI/OSCSI controller
bus masterIOISCSI ID
bus masteringIomega CorporationSCSI initiator
bus networkI-OOASCSI interface
bus topologyI/O redirectionSCSI reconnect
Busy BeaverIOSSCSI target
busy-loopIotaScumOS
busy-waitIOT&Escuzzy
Butterfly Common LISPIOWSD
Butterfly SchemeIPsd
buttonIPASDDI
buzziPadSDE
bvIP addressSDF
bwIPARSSDH
bwBASICI-PaySDI
BWQIPCSDK
byipconfigSDL
byaccIPCPSDL 92
by handIPESDLC
ByteIperfSDM
byteIPLSDMS
byte-codeIP next generationSDP
byte-code compilerIPngSDRAM
byte-code interpreterIP numberSDRC
byte compilerIPSSDR-RAM
bytesexualIPSESDR-SDRAM
ByzantineIPsecSDS
bzIPTSDS 92
bzzzt, wrongIP TelephonySDS 940
CIPv4SDSL
C#IPv6SE
(c)IPXse
C*IPXCPSEA
C++IQSeagate Technology
C+-iqSEAL
C+@IQLsearch
C-10IRsearch algorithm
C1 securityirsearch-and-destroy mode
c2manIrBUSsearch engine
C2 securityIRCsearch problem
c386ircopsearch term
C5IRC penis war{searchTerms}
C64IrDASearch The Fucking Web
c68IrDA-CSEC
CAIrDA ControlSECC
caIrDA DataSECD machine
cable modemIRDATAsecondary cache
cacheIRDPsecondary damage
cache blockIRDSsecondary key
cache coherencyIRETsecondary storage
cache conflictIRISsecond generation
cache consistencyIrissecond generation computer
cache hitIRISAsecond generation language
cache lineIRIS Explorersecond level cache
cache memoryIRIXsecond normal form
cache missIRLSecond-Order Lambda-calculus
Cache On A STickIRMsecond-system effect
cachingironsector interleave
CACIIron Agesector interleaving
CACMiron boxsector map
CADIronmansector mapping
CAD/CAMironmongerSecure File Transfer Protocol
CADDIRQSecure Hash Algorithm
Cadence Design Systemsirrational numberSecure Multipurpose Internet Mail Extensions
CADETirrefutableSecure Shell
CADREIRSGSecure Sockets Layer
CAEIRTFsecurity
CAFIRUSSecurity Administrator's Integrated Network Tool
CAFEIrvine DataflowSecurity Association
CAGEIrvine Research Unit in SoftwareSecurity Association ID
CAIISsecurity through obscurity
CairoisSED
CAISIS-11172Sed
CAIS-AIS-13818SEE
CAiSEISAseed
CAJOLEIsabelleseek
CALIsabelle-92seeking
CalcIsabelle-93seek time
calculatorISA busSEESAW
Calculus of Communicating SystemsISAKMPsee u see me
Calendar APIISAMSEGA
Calendar Application Programming InterfaceISAPISega Genesis/MegaDrive
CalibanISAPI filtersegfault
CalicoISBLseggie
California State University San MarcosISDEsegment
callbackISDNsegmentation
call-by-nameISEsegmentation and reassembly
call-by-needISEEsegmentation fault
call-by-referenceI see no X here.segmented address space
call-by-valueISETLsegv
call-by-value-resultISFSEI
call/ccISINDEXSeiko RC-4000
Call Data RecordISISSEL
calleeIS-ISSelective Dissemination of Information
Caller IDISLselector
calling conventionISLispSelf
Call-Level InterfaceISMAPSelf-Extensible Language
Call UnixISOSelf Extracting Archive
CallwareISO 10646self-reference
call-with-current-continuationISO 3166selvage
CALSISO 639-1SEM
Caltech Intermediate FormISO 639-2semantic gap
CAMISO 8072semantic network
CAM-6ISO 8073semantics
CAMALISO 8208semaphore
Cambridge LispISO 8326semi
Camelot LibraryISO 8327Semi-Automatic Ground Environment
camera readyISO 8485semicolon
CAMILISO 8613semiconductor
CAMLISO 8649Semidetached Mode
Caml LightISO 8650SENDIT
CAM-PCISO 8805sendmail
Campus Wide Information SystemISO 8807sendmail.cf
CANISO 8822Sendmail Inc.
CanadaISO 8823Seneca
CancelISO 8825senior bit
CancelbunnyISO 8859sense
Cancelm00seISO 8859-1sensor
CancelmooseISO 8879sentence
CancelpoodleISO 9000SE-ODP
candidate keyISO 9072SEP
CandleISO 9660separate compilation
candygrammarISO 9735SEPIA
canonicalISOCSEPP
Canonical Encoding RulesISO CSeque
canonical nameisochronousSequel
canonicityisochronous transferSequenced Packet Exchange
C (ANSI)ISODEsequencer
can't happenISO Development EnvironmentSequent
CantorISO/IEC 10646-1sequential coding
CAPISO/IEC 26300sequential file matching
Capabilities Maturity ModelisolatedSequential Parlog Machine
capabilityISO Latin 1sequential processing
Capability Maturity Modelisometric joystickSERC
capacitorisometrySERCOS
capacityisomorphicserial
CAPIisomorphismSerial Advanced Technology Attachment
Cap'n Crunchisomorphism classSerial ATA
Captain AbstractionISO Pascalserial communications
Captain CrunchISO seven layer modelSerial Communications Interface
CAPTCHAISPSerial Interface Adaptor
CARISPBXserial IO chip
cardISPFserialise
Cardbox for WindowsISPLserialize
CardbusISPSserial line
card creepISTSerial Line Internet Protocol
cardinalityISTARSerial Line IP
cardinal numberISTMSerial Peripheral Interface
CARDSISVserial port
card walloperISWIMSerial Presence Detect
Career Limiting MoveITserial processing
caretitserial processor
carewareITARSerial Storage Architecture
cargo cult programmingIterated Function Systemserve
Caribou CodeWorksiterationservelet
Carl Friedrich Gaussiterative deepeningserver
Carnegie Mellon Universityiteratorserverlet
carpal tunnel syndromeIternetServer Message Block
Carriage ReturnIT governanceserver-parsed HTML
Carrierless Amplitude/Phase ModulationITHACAserver room
carrier scannerITILservers
carrier signalITPserver-side
Cartesian coordinatesITSserver-side include
Cartesian productit's a featureservice
CASITSPserviceability
CAS 8051 AssemblerITUService Access Point
cascadeITU-TService Advertising Protocol
Cascading Style SheetsITU-T X.680Service Discovery Protocol
CASEITU X.209service-oriented architecture
caseIvanservice provider
case and pasteIvan SutherlandService Set Identifier
case based reasoningIverson's Languageservlet
CASE Data Interchange FormatIVRsession
CASE frameworkivsSession Initiation Protocol
case insensitiveIVTRANsession layer
Case Integration ServicesIV&VSES/workbench
CASE*MethodIVYSET
case sensitiveIWayset
case sensitivityIWBNIset abstraction
CASE SOAP IIIIXCset associative cache
case statementIXI Limitedset complement
CASE toolsIXOset comprehension
casheIYFEGSetext
CASTJSETL
castJ2EESETL2
casters-up modeJ2MESETL/E
casting the runesJ2SESet Priority Level
CATJ3SETS
catJ73set theory
Cat 3jabberset-top box
Cat 5JACALSEUS
catatonicjacclseven layer model
CATEjack inSeven-Segment Display
Categorical Abstract Machine LanguageJack KilbySEX
categoryJackson methodsexadecimal
Category 3Jacquard, Joseph-Mariesex changer
Category 5Jacquard loomSEXI
CA-TelonJADSeymour Cray
cathode ray tubeJADESFA
CATIAJadeSFBI
cationic cocktailjadeTeXSFD-ALGOL
C/ATLASJAffer's Canonical ALgebraSFFA
CATNIPjaggiesSFL
CATOJaMSFLV
Cauchy sequencejamsFTP
cause-effect graphingJames Clarksg
CAVJames' DSSSL EngineSGCP
Cayenne SoftwareJames GoslingSGI
CAYLEYJames H. ClarkSGML
cbJAM Programming Languagesgmls
CBASICJANETSGML Tagger
CBBSJANET IP ServiceSGRAM
C-BCJanussh
CBDjaphSHA
C BeautifierjarSHACO
CBIRjargonSHADOW
CBNJargon Fileshadowing
CBRJavashadow ram
CBTJava 2shallow binding
CBVJava 2 Platformshambolic link
cbwJava 2 Platform, Enterprise EditionShape_VC
ccJava 2 Platform, Micro EditionShapeTools
CC++Java 2 Platform, Standard Editionshar
C/C++Java 2 SDKsharchive
CCalcJava 2 Software Development Kitsharding
CCDJava archiveShare and enjoy!
CCIRNJavaBeansshared memory
CCITTJava Community ProcessShared Time Repair of Big Electronic Systems
CCITT HIgh-Level LanguageJava Database Connectivityshareware
CCLJava Development Kitshar file
CCLUJava Message Servicesharp
ccmailJava Native InterfaceSharp APL
cc:mailJava Open Language ToolkitS-HDSL
CCPJava Remote Method Protocolshebang
CCRJava Run-Time EnvironmentSHEEP
CCSJavaScriptshelf
CCSPJavaScript Object Notationshelfware
CCTAJava serveletSHELL
CDJavaServer Facesshell
cdJavaServer Pagesshell out
CDAJava servletshell script
CD burnerJava Servlet Development Kitshell variable
CDCJava Virtual Machineshielded twisted pair
CDC 6600Java VMSHIFT
CDDIJAZShift In
CDD/PlusJazshift left logical
CDEJaz DriveShift Out
CDFJAZELLEshift right logical
CD-iJBIGshim
CDIFJBODshit hit the fan
CDLJBOPSshitogram
CDMjcShockwave
CDMAJCLshockwave
CDP1802JCOOLShockwave Flash
CDPDJCPshopbot
CDRJCS-13short card
CD-Read-WriteJDBCShort Code
CD-RewritableJDKshortcut
CD-ROMJEANShorten
CD-ROM driveJean E. Sammetshortest job first
CD-RWJean-Maurice-Émile BaudotShort Message Service
CDSJEDRshotgun debugging
cd tildeJef Raskinshoulder surfing
CDWJenga Codeshovelware
CEJerry SussmanShow-And-Tell
CecilJESshowstopper
CedarJES2shriek
CEEMAC+JES3shrug report
CEI-PACTJFCLsht
CeleronJFDISHTF
CELIPJFETshtml
cellJFGIShub-Internet
CellangJFIFSHUG
CELLASjiffyShugart, Alan F.
CelloJim ClarkShugart Associates
cell referenceJiniShugart Technology
CELLSIMJIPSSI
CEll Space Simulation LanguageJITsi
CellularjitterSIA
cellular automataJK flip-flopSIBO
cellular automatonjmSICL
Cellular Digital Packet DataJ.M.E. BaudotSICS
cellular multiprocessingJMHOSICStus Prolog
Cellular Neural NetworkJMSsidecar
CELPJNIside-effect
CENjoSiemens
CENELECjobSiemens Nixdorf Informationssteme, AG
centi-call secondJob Control LanguageSierra
central officeJob Entry SystemSIFT
Central office exchange serviceJobsSIG
central processing unitjob securitySig
Centrexjocksig
Centronicsjoesig block
Centrum voor Wiskunde en Informaticajoe codeSIGBUS
centum call secondJohn AtanasoffSIGhyper
century meltdownJohn GilmoreSIGLA
CEN/XFSJohn MauchlySIGMA
cepstraJohn McCarthySIGNAL
cepstrumJohnniacsignal
CEPTJOHNNIAC Open Shop Systemsignalling rate
CERJohn OusterhoutSignalling System 7
Ceramic Pin Grid ArrayJohn Tukeysignal-to-noise ratio
Ceres workstation Oberon SystemJohn Vincent Atanasoffsignature
Cerf, VintJohn von Neumannsig quote
CERNjoinsig virus
CERNLIBJoint Academic NETworkSIL
CERTJoint Bi-level Image Experts GroupSilage
Certificate AuthorityJoint Photographic Experts Groupsilicon
CESPJoint Technical Committeesilicon chip
CESSLJoint Test Action GroupSilicon Graphics, Inc.
cextractJolietSiliwood
cfjolixsilly walk
CFDJOLTsilo
CFMLJonathan's Own Version Of EmacsSilver Book
cforthJon Postelsilver bullet
cfortran.hJOOPSIM
CFPJoseph-Marie JacquardSIMAN
CFP92Josephson JunctionSimCity
cgJOSSSimCity 2000
CGAJossleSIMD
CGGLjournalSimilix
CGIjournallingSIML/I
cgi-binjoveSIMM
CGI JoeJOVIALSimone
CGI programJoySimonyi, Charles
CGI scriptJoyceSIMPAC
CGMjoystickSIMPAS
CGOLJoy, WilliamSIMPL
cgramjpSIMPLE
ChJPEGSimple Actor Language
chJPEG-2000Simple Authentication and Security Layer
chadJPEG File Interchange FormatSimple Gateway Control Protocol
chad boxjpgSimple Mail Transfer Protocol
Chadless keypunchJPLsimple multicast protocol
chainJPLDISSimple Network Management Protocol
Challenge-Handshake Authentication ProtocolJ. Presper EckertSimple Network Management Protocol version 2
Chalmers University of TechnologyJ. RandomSimple Network Paging Protocol
change managementJ. Random HackerSimple Object Access Protocol
changeoverJREsimplex
channelJRLsimplex method
channel associated signalingJRMPsimplex printer
channel hoppingJRNSIMPL/I
channel opJRSTSimplified Multicast Routing Protocol
channel service unitJSSIMPL-T
channel service unit/data service unitJSASIMSCRIPT
chan opJSDKSIMSCRIPT I.5
chaosJSFSIMSCRIPT II.5
CHAPJSONsimship
charJSPSIMULA
characterJTAGSIMULA 67
character encodingJTBSIMULA I
character encoding schemeJTCsimulate
character graphicsJTC1/SC24simulated annealing
characteristic functionJTSSimulating Digital Systems
character keyjuggling eggssimulation
character repertoireJugheadSIMulation ANalysis
character setjukeboxSimulation Language for Alternative Modeling
character set identifierjumpSimulation Oriented Language
charge-coupled devicejumperSimultaneous Engineering Environment
CHARITYjump off into never-never landSimultaneous Peripheral Operation On-Line
charitywarejump trace buffersimultaneous shipment
Charles BabbageJunction FETSimware, Inc.
Charles SimonyiJunction Field Effect TransistorSINA
CHARMJunosince time T equals minus infinity
CHARM++jupiterSinclair, Clive
CharmeJust a Bunch Of DisksSinclair PC200
CHARYBDISjust-in-timeSinclair Radionics
chase pointersJVMSinclair Research
CHASMJymsine wave
chatKsingle assignment
chatbotK5single assignment language
chat roomK56flexsingle-attached
chatterbotK6Single Connection Attach
CHeap ASseMblerK7Single Connector Attachment
cheapernetKA9QSingle Data Rate Random Access Memory
checkdigitKADSSingle Data Rate Synchronous Dynamic Random Access Memory
Checkout Test languagekahunaSingle Document Interface
checkpointKaleidoscopesingle-duplex
checksumKaliSingle Edge Contact
chemistkamikaze packetSingle Edge Contact Cartridge
ChenKamin's interpretersSingle Edge Processor Package
CHEOPSkanasingle-electron transistor
Chernobyl packetkangaroo codeSingle Electron Tunneling
chesskanjiSingle Electron Tunneling Technology
CHIKAOSsingle ended
ChicagoKAPSingle Image Random Dot Stereogram
chicken headKarelsingle inheritance
chicklet keyboardkatakanaSingle In-line Memory Module
chiclet keyboardKatmai New InstructionsSingle Inline Pin Package
Chief Information OfficerKBSingle Instruction Multiple Data
childKBMSSingle Instruction/Multiple Data
child processkbpsSingle-line Digital Subscriber Line
child recordKBSSingle-pair High Speed Digital Subscriber Line
child versionKC-85/1single program/multiple data
CHILIKC85/2single quote
CHILLKC85/3single sign-on
ChimeraKC85/4single sourcing
chine nualKCLsingle static assignment
Chinese Army techniquekesingleton variable
CHIPKEESingle Virtual Storage
chipkeep-alivesiod
CHIP-48Keldysh Institute of Applied MathematicsSIP
CHIP-8kenSIPB
chip artKen ThompsonSIPLAN
chip boxKent Recursive CalculatorSIPP
chip creepKerberosSI prefix
chip graffitiKermitSiprol
Chip JewelrykernalSIR
Chip Scale PackagingkernelSIRDS
chip setKernel ParlogSiri
Chips & TechnologiesKernel User Interface PackageSIRTS
CHISELkerningSISAL
chmKevosit
chmodkeySITBOL
CHOCSkeyboardsite map
chokeKeyboard Commandositename
chompkeyboard plaqueSIxteen Bit Organisers
CHOPKeyboard Send Receivesj
ChopKeyboard Video Mousesk
ChorusKeyed-Hashing Message AuthenticationSkel-ML
Christmas treeKeyed Sequenced Data SetSketchpad
Christmas tree packetkey escrowS/Key
Christopher Stracheykey fieldSkill
chromatic numberkey frameSkim
chromeKeyNote SoftwareSkipJack
chrootkeypadSKOL
CHRPkeypalskolemisation
chugKeySpellS-K reduction machine
chug reportkeywordskrog
chunkerkeyword in contextSKsh
Church, AlonzoKFXSKU
Church integerkgskulker
Church of the SubGeniuskgbvaxSL
Church-Rosser Theoremkhsl
ciKhornerstoneSL5
CI$Khwarizmislack
CICEROkislackware
CichlidkibibyteSLAM
CICSKIBOSLANG
CIDkibozeS-Lang
CIDRkickslap on the side
CIELkicking dead whales down the beachslash
CIFKidslashdot effect
CIFSKIDASA Softwareslave tty
Cigalekiller microSLD resolution
CILkiller pokesleep
CIMkill fileSLIB
CIMS PL/Ikilo-Slide
Cinderella Bookkilobaudsliding-window
CINT92kilobitSLIM
C-Interpkilobits per secondslim
CIOkilobyteSlingshot
ciphertextkiloflopsSLIP
CIP-LkioskSlipKnot
CIP LanguageKIPSSLIPS
CIRKISSLiRP
CIRCALKISSSLLIC
circuitKISS Principleslog
CIRcuit CALculuskitSloop
circuit switchKL0slop
circuit switchedKL1slopsucker
circuit switchingKlamathslosh
circular bufferKLBSlot 1
Cirrus LogicKleene closureSlot 2
CISKleene starSlot A
CISCKleene, Stephen Coleslurp
Cisco Systems, Inc.Klerer-May Systemsm
CISIKLOCsmail
CITRANkloneSMALGOL
CityScapeKL-ONESMALL
CIXkludgeSmall Business Edition
CJKklugeSmall-C
CJKVkluge aroundSmall Computer System Interface
ckkmsmall-office/home-office
CLKMODELSmall Outline DIMM
clKMSSmalltalk
CLAMknSmalltalk-80
C Language Integrated Production Systemknapsack problemSmalltalk/V
ClarifyKNISmallVDM
ClarionKnights of the Lambda-CalculusSMALLWORLD
ClarisknowbotSmallWorld
CLASPKnowbot Information ServiceSmarandache logic
classknowledgeSMART
Class 5 switchKnowledge Analysis and Design Systemsmart
class hierarchyknowledge baseSmart Battery Data
classicknowledge-based systemsmart card
Classic-Adaknowledge levelSmartdrive
classical logicKnowledge Management SystemSMARTdrv
Classic CKnowledge Query and Manipulation Languagesmart terminal
Classless Inter-Domain Routingknowledge representationsmash case
class libraryKnowledge Sharing Effortsmash sum
class methodKnowledge Systems Laboratorysmash the stack
class objectKnown Lazy BastardSMB
Class Oriented Ring Associated LanguageKnuthsmbclient
Class-Relation MethodKodaksmblib
Clausal LanguageKohonenSMBus
clauseKOMPILERSMCC
CleanKonrad ZuseSMDS
cleanKorf, RichardSMG
cleanroomKorn ShellSMI
CLEARkpSMIL
clear box testingKQMLsmiley
Clear Language for Expressing OrdersKRsmilies
CLEOkrS-MIME
CLHEPK&RSML
CLIKRCSML#
CLiCCK&R Csml2c
clickkremvaxSML/NJ
clientKRLSMM
client-serverKRSSMNP
client/serverK&R stlyesmoke
Client-Server Analyst ProgrammerKRYPTONsmoke and mirrors
client-server modelkshsmoke-emitting diode
Client To Client ProtocolKSLsmoke test
C++LindaKSRsmoking clover
C-LindaKTHSMoLCS
CLIPkthxSMOP
CLiPKUIPSMP
clipboardKungliga Tekniska HögskolanSMPS
ClipperKUTGWSMPT
CLIPSKvatro Telecom ASSMRP
cliqueKvikkalkulSMS
CLISPKVMSMT
Clive SinclairkwSMTP
CLIXKWICsmug report
CLMkysmurf
CLNPKyoto Common Lispsn
clobberkyrkaSNA
clockkzsnacc
clock frequencyL0snaf
clock rateL0phtSNAFU principle
clock speedl10nsnag
cloneL1 cachesnail mail
clone-and-hack codingL2 cacheSNAP
clonebotL2CAPsnap
CLOSL2TPsnap dump
closed-box testingL6Snappy
closed setlaSnappy Video Snapshot
closed termlabelsnarf
Clos networklabel edge routersnarf & barf
closureLabel Forwarding Information Basesnarf down
closure conversionlabel switched pathsnark
cloudlabel switchingsneakernet
cloud computingLabel Switching Routersneck
CloverLab for Computer Sciencesnert
clover keyLaboratoire lorrain de recherche en informatique et ses applicationsSNI
CLPLaboratory INstrument ComputerSniff
CLP*Laboratory Virtual Instrument Engineering Workbenchsniff
CLP(R)LaborNetsniffer
CLP(sigma*)Labtech Notebooksnivitz
CLRLabVIEWSNMP
CLtL1LaceSNMP agent
CLtL2lace cardSNMPv2
CLUladder logicSNOBOL
clu2cLADYSNOBOL2
clusterlagSNOBOL3
Cluster 86LakotaSNOBOL4
clustergeekingLALRSNOOPS
clusteringlalr.ss'Snooze
CLUTLambada-CalculusSNPP
CLVLAMBDASNR
CLXlambda abstractionS/N ratio
CMlambda-calculusSNR bandwidth product
cmlambda expressionSO
CMAlambda liftingso
CMAYLambdaMOOSO 2
CMCLambda PrologSOA
cmdlamerSOAP
CMGALAMINASOAR
CMIPlamp-post errorsocial engineering
CMISLANsocial network
CMLLAN administratorsocial networking
CMMLANCEsocial science number
CMOSlanguagesocket
CMPlanguage-based editorSocket 1
CMSlanguage codeSocket 2
CMS-2Language for Communicating SystemsSocket 3
CMULanguage for the On-Line Investigation and Transformation of AbstractionsSocket 370
CMU CLLanguage HSocket 4
CMU Common Lisplanguage lawyerSocket 5
CMVCLanguage Of Temporal Ordering SpecificationSocket 6
CMYKLanguage Sensitive EditorSocket 7
CMZlanguage-sensitive editorSocket 8
cnlanguages of choiceSOCKS
CNAMELaning and ZierlerSOCRATIC
CNCLan Kanal AdapterSODA
CNETLANLSODAS
CNILan ManagerSO-DIMM
CNNLANtasticSod's Law
CNRLAPSOE
CNRILAP4SoftBench
coLAPBsoft boot
CO2LAPDsoftcopy
Coad/YourdonLAPMSoftlab
COALALAPSEsoft link
coalesced sumlaptopSoftModem
Coalition for Networked Informationlaptop computerSoftVelocity Inc.
coarse grainLaQueysoftware
COASTLarchSoftware AG
coaxLarch/C++software audit
coaxial cableLARCH/CLUSoftware BackPlane
COBOLLarge Installation Systems Administrationsoftware bloat
COBOL-1961 ExtendedLarry WallSoftware bus
COBOL fingersLARTsoftware copyright
COBRAlarval stageSoftware Description Database
cobwebsitelaseSoftware Developers Kit
Cocktaillasersoftware development life cycle
cocktail shaker sortlaser printersoftware enabling
CoCoLasherismsoftware engineering
Cocollast call optimisationSoftware Engineering Environment
Coco Languagelast-in first-outsoftware handshaking
Cocol/RLATsoftware interrupt
COCOMOlatchSoftware in the Public Interest, Inc.
Coco/Rlatencysoftware laser
CODASYLLaTeXsoftware law
Codd's First Normal FormLatin 1software life-cycle
Codd's reduction algorithmlatticeSoftware Method
codeLAUSoftware Methodology
Code 2.0laundromatsoftware metric
codebookLAUREsoftware patent
CODECLAVAsoftware piracy
CodeCenterlawsoftware pirate
coded character setLAWNSoftware Practice and Experience
Code Division Multiple AccessLawrence Livermore LabsSoftware Productivity Centre
code division multiplexingLawrence Livermore National LaboratorySoftware Publishing Certificate
Code-Generator Generator LanguageLAXSoftware Publishing Corporation
code grinderlayersoftware reliability
code managementlayer 1software rot
code policelayer 2software theft
code positionlayer 3Software through Pictures
coder/decoderlayer 4software tool
codeslayer 5Software Verification Research Centre
C-odeScriptlayer 6Software Writer's Language
code segmentlayer 7softwarily
code walkLayer Two Tunneling Protocolsofty
codewalkerlazinessSOH
CODILlazy evaluationSOHIO
codomainlazy listSoHo
coercionLazy SMLSOIF
COFFlazy sml2cSOJ
COGENTLazy Standard MLSOL
Cogent ProloglbSolaris
CognitechLBAsolid state
cognitive architectureLBESolid State Disk
COGOLBLsolid-state storage device
Coherent Parallel CLBXSOLO
COHESIONlcsolution
COIFLCCSolution Based Modelling
CoIPlccSolve
cokebottleLCDSOM
COLASLLCFSomar DumpAcl
COLDLCLSomar Software
cold bootlclintsome random X
ColdFusionLCPSonata
ColdFusion Markup LanguageLCSSONET
COLD-KldSony Playstation
COLINGOLDAPSORCERER
collisionLDBsorcerer's apprentice mode
collision detectionLDLsort
collocationLDL1sorting
co-locationLDPSOS
colonLDTsound
colorLE/1Sound Blaster
Color Graphics Adapterleadingsound card
color modelLEAFsoundex
Colossusleafsoundness
colourLeaf Distribution Limitedsource
colour depthleaf sitesource code
colour look-up tableLeague for Programming Freedomsource code control
colour modelleaksource code escrow
colour paletteleaky heapsource code management
Columbia AppleTalk PackageLeansource language
columnLEAPsource-level debugger
Column Address Strobeleapfrog attacksource of all good bits
COMleap secondsource package
comlearning curvesource route
.comleased linesource routing
COMALleast fixed pointsouthbridge
combinationleast recently usedSP
combinatorleast significant bitSP2
combinatory logicleast upper boundSP/2
Comdexleavesspace
COME FROMLECspace bar
COMISLECOMspace-cadet keyboard
COMITLEDspace complexity
Comite Europeen des Postes et TelecommunicationsLEDAspace key
COMIT IILedaspace leak
CommaLED page printerSPACEWAR
commaLED printerSPADE
commandleechspaghetti code
Command Control Processorleetspaghetti inheritance
command interpreterleft arrowspaghetti with meatballs code
command keyleft bracespam
command line interfaceleft bracketspamdex
command-line interpreterleft joinspamming
command line optionleft outer joinspanning tree algorithm
comma separated valuesleft parenthesisSPAR
COMMENLeFunSPARC
commentlegacySPARC International, Inc.
commented outlegacy codeSPARCStation
comment outlegacy softwareSPARCstation 10
commercial atlegacy systemSPARCstation 20
Commercial Internet eXchangelegalSPARCsystem 4
commercial off-the-shelf softwarelegaleseSPARC Xterminal 1
commercial softwareLEGOLSPARK
Commercial TranslatorLe-LispSPARK Annotation Language
Committed Data RatelemmaSPARKS
Committed Information RateLempel-Ziv compressionsparse
comm modeLempel-Ziv Welch compressionSpatial Technologies
CommodoreLenat, Dougspawn
Commodore 1010lenient evaluationSPC
Commodore 128LEOSPD
Commodore 1541LeoSPDL
Commodore 1570LERSPE
Commodore 1571LERPSpeakeasy
Commodore 1581less thanspeaker
Commodore 64LessTifSPEC
Commodore 64DXlet floatingSpec
Commodore 65letterbombspec
Commodore Business Machineslevel 1 cacheSPECbase_fp92
Commodore SX64level 2 cacheSPECbase_int92
COMmon Algorithmic LanguageLEVEL5 OBJECTSPECbaserate
Common Applications Environmentlevel one cacheSPEC CFP92
Common Applications Service Elementlevel-sensitive scan designSPEC CINT92
Common Architecture for Next Generation Internet Protocollevel two cacheSPECfp92
COmmon Business Oriented LanguageLexSPECIAL
common carrierlexemespecial-case
Common Command SetlexerSpecial Interest Group
Common Communication Serviceslexical analyserspecialisation
Common Desktop Environmentlexical analysisspecification
Common ESPlexical scopespecific markup
Common Gateway Interfacelexical scopingSPECint92
Common Hardware Reference PlatformlexiphageSPECmark
Common Information ModelLFSPECmark89
Common Intermediate FormatLFIBSPECOL
Common Intermediate LanguageLGSPEC rate
Common Internet File SystemLGDFSPECrate_base_fp92
Common-ISDN-APILGENSPECrate_fp92
Common ISDN Application Programming InterfaceLGNSPECrate_int92
Common LisplhaSPEC ratio
Common LISP in ParallelLHARCSpectral Band Replication
Common LISP Object SystemlhsSpectrum
CommonLoopslispeculative evaluation
Common Management Information ProtocolLianaspeculative execution
Common Management Information ServicesLiarSpeech Application Programming Interface
Common Object File Formatliar paradoxspeech recognition
Common Object ModellibSpeech Recognition Application Program Interface
Common Object Request Broker Architecturelibg++speech synthesis
Common ObjectslibrarySPEED
Common Program InterfaceLibrary of Efficient Data types and AlgorithmsSpeedcoding
Common User AccesslibrerySpeedcoding 3
Commonwealth HackishLIDOSPEEDEX
Communicating Functional ProcessesLiEspeedometer
Communicating Sequential ProcessesLIFspell
Communication and Network RiserLIFEspelling flame
Communications Decency ActLifeSperry Corporation
Communications of the ACMlifeSperry Univac
communications portlife-cycleSPG
Communications ServerLife is hardSPGA
communications softwareLIFIASPI
communication systemLIFOSpice Lisp
Community of Massive Gaming Agencylifted domainSPID
COMNETLIGHTspider
compactlight clientSpiderweb
Compact COBOLlight-emitting diodespiffy
Compact Disclight-emitting resistorspike
Compact Disc interactivelight penspill
Compact Disc Read-Only Memorylight pipespim
Compact Disc Read-Writelight-weightspin
Compact Disc RecordableLightweight Directory Access Protocolspin control
Compact Disc Rewritablelight-weight processspinner
Compact Disc writerlike kicking dead whales down the beachspiral model
compactionlike nailing jelly to a treeSPIT
compactness preservinglike thisSPITBOL
Compaq Computer CorporationLilaspiware
Compas PascalLilithSP/k
COMPASSLILLIAC IVSPL
compatibilityliloSPL/1
compatibleLilySPLash!
Compatible Timesharing SystemLIMDEPsplash screen
CompelLIM EMSsplat
Competitive Access ProviderLIMPSPL/I
Compiled HTMLLincSPLINTER
compilerLincoln Reckonersplit
COmpiler and GENeralized TranslatorLINCtapeSplit-C
compiler compilerLindasplot
Compiler-CompilerLindaLISPSPLX
compiler-compilerlineSPM
compiler jockline 666SPMD
Compiler Language for Information Processinglinear address spaceSPML
Compiler Target Languagelinear argumentspod
compile timelinear assignmentspoiler
COMPLlinear functionsponge
complementLinear Graph Notationspoo
Complementary Metal Oxide Semiconductorlinear logicspoof
complementary nondeterministic polynomiallinear mapspoofing
completelinear programmingspooge
complete graphlinear spaceSPOOL
complete inference systemlinear topologySpool
complete latticelinear transformationspool
complete metric spacelinear typespooler
completenessline conditioningspool file
complete partial orderingline eaterSpoolView
complete theoryline editorspray
complete unificationline feedspreadsheet
Complex Instruction Set Computerline noisespread spectrum communications
complexityline printerSPRING
complexity analysisline probingSPRINT
complexity classlines of codeSprintnet
complexity measurelines per minuteSprite
complex numberline starvesprite
complex programmable logic deviceLingosprocket feed
componentLINGOLSPS
component architecturelinkSPSS
component based developmentLink Access Procedure on the D channelSPSS, Inc.
Component Integration LaboratoriesLink Access Protocol BalancedSPUR
Component Object ModelLink Access Protocol for ModemsSPX
com portlinkage editorspx
compositeLink Control Protocolspyware
compositionlink-dead\sqcap
Compositional C++link editor\sqcup
Compound Document Architecturelinked listSQE
compound keylinkerSQL
COMPREHENSIVElink farmSQL2
Comprehensive Perl Archive Networklink loaderSQL3
Comprehensive TeX Archive Networklink rotSQL Access Group
compresslinksSQL/DS
Compressed SLIPLink State Routing ProtocolSQL Module Language
compressed videoLINPACKSQL Server
compressionlintSQL server
COMPROSLLinuxSQLWindows
Compu$erveLinux Documentation ProjectSQR
Compulink Information eXchangeLinux LoaderSQRIBE
CompuServeLinux Network Administrators' Guide\sqsubseteq
CompuServe CorporationLinux User GroupSquare
CompuServe Information Servicelion foodsquare-headed boyfriend
CompuServe Interactive ServicesLions Booksquare-headed girlfriend
Compusult Ltd.LIPLsquare tape
computability theoryliquid crystal displaySqueak
computableLISSquiggol
Computational Adequacy TheoremLISAsquirt the bird
computational complexityLiskov, BarbaraSR
Computational Fluid DynamicsLiskov substitution principlesr
computational geometryLispSRAM
computational learning*LISPSRAPI
computational molecular biologyLISP 1SRC Modula-3
COMpute ParallELLISP 1.5SRDL
ComputerLISP 2SR flip-flop
computerLISP70SRI
Computer Aided DesignLISP ASRI International
Computer Aided Detector DesignLISP Extended Algebraic FacilitySRL
Computer Aided EngineeringLispkitSRP
Computer-Aided InstructionLispkit LispSS7
Computer-Aided LearningLisp-LindaSSA
Computer Aided Software EngineeringLisp MachineSSADM
Computer-Aided Software TestingLISP Machine LISPSSBA
Computer Aided Test EngineeringLisp Object-Oriented Programming SystemSSD
Computer Animation Movie LanguageLISP, Objects, and Symbolic ProgrammingSSE
Computer-Assisted LearningLisptalkSSE-2
Computer-Assisted Software EngineeringLispViewssh
Computer Associates International, Inc.listSSH File Transfer Protocol
Computer-Based Traininglist comprehensionSSI
computer busList EnhancedSSID
Computer CompilerlistlessSSII
computer confettiListprocSSL
Computer Conservation SocietylistsS/SL
computer cookieListservSSLeay
computer crimeLisztSSMA
Computer Design LanguageliteSSO
computer dictionaryliteralSSR
Computer Emergency Response Teamliterate programmingst
computer ethicsliteratureST-506
computer fileLITHESTAB
computer geeklithium lickSTAB-11
computer-generated imageryLitProgSTAC
Computer Generation IncorporatedLITTLEstac compression
Computer Graphics Metafilelittle-endianstack
Computer Integrated ManufacturingLittle SmalltalkStack Environment Control Dump machine
computer languagelive datastack frame
Computer Language for AeronauticS and ProgrammingLive Free Or Die!stacking order
computer lawlivelockstack loader
computer literacyLiveScriptstack overflow
Computer Management Group of Australialivewarestack pointer
Computer Mediated Communicationlkstack puke
computer nerdLKAstack traceback
computer networkLLSTAGE2
Computer Output on MicrofilmLLCStaggered Pin Grid Array
Computer Output to Laser DiscLLGenstaircase
Computer Output to Laser DiskLLM3staircasing
Computer Professionals for Social ResponsibilityLLNL@stake
computer programLLPstale pointer bug
Computer + Science NETworkLM3Stallman, Richard M.
computer securityLMAOstand-alone
computer sexLMDSstandard
Computer Software Configuration Itemlmgtfy.comStandard Commands for Programmable Instruments
Computer-Supported Collaborative LearningLMLStandard d'Echange et de Transfert
Computer Supported Cooperative WorkLM-Prologstandard deviation
Computer Telephone IntegrationLMTPstandard for robot exclusion
Computer TelephonyLNFStandard for the exchange of product model data
Computer Telephony IntegrationLOStandard Generalised Markup Language
computer virusL&OStandard Generalized Markup Language
computer visionloadstandard input/output
compute serverload balancingStandard Instrument Control Library
computingload-bearing printfstandard interpretation
Computing Devices Canada Ltd.lobotomystandard I/O
computing dictionaryLOCStandard Lisp
computronlocal area networkStandard ML
Compuware CorporationLocal Area TerminalStandard ML of New Jersey
COMSLlocal busStandard Operating Environment
COMTRANlocalestandard semantics
ConClocal echoStandard Widget Toolkit
concatenatelocal exchange carrierSt Andrews Static Language
concatenated keylocalisationStanford Artificial Intelligence Laboratory
concentratorlocalisedStanford Artificial Intelligence Language
conceptualisationlocalityStanford Research Institute
Concert/Clocal loopStanford University
ConCoordlocal loopback addressesSTAPLE
concrete classLocal Mail Transfer ProtocolStaple
Concrete Data StructureLocal Multipoint Distribution SystemSTAR 0
concrete syntaxlocalsStarBurst
CONCURLocal Shared ResourcesStarLISP
concurrencyLocalTalkStarMOD
Concurrent Clocal variablestar network
Concurrent C++locationStarset
Concurrent CleanLoch Ness Monster BugSTARSYS
Concurrent CLUlocked and loadedstart bit
Concurrent Constraint Programminglocked upstart of authority
Concurrent Euclidlock-inStart Of Header
Concurrent LISPLocusStart Of Text
Concurrent Massey HopeLoebner Prizestart tag
Concurrent MLlogstate
Concurrent Oberon{log}state diagram
Concurrent Object-Oriented Clogarithmus dualisstateless
Concurrent Object-Oriented LanguageLogCstate machine
Concurrent Pascallogicstatement
concurrent processinglogicalstate transition diagram
Concurrent Prologlogical addressState University of New York
Concurrent SchemeLogical Block Addressingstatic
ConcurrentSmalltalklogical complementstatically typed
Concurrent SP/kLogical Interchange Formatstatic analysis
Concurrent Versions SystemLogical Link Controlstatic database management system
condelaLogical Link Control and Adaptation Protocolstatic DBMS
condition outlogical relationstatic link
condomlogical shiftstatic method
Conference On DAta SYstems Languageslogical shift leftstatic nested scope
Conferencing over IPlogical shift rightstatic nested scoping
confidence testLogical Unitstatic RAM
CONFIG.SYSLogical Unit 6.2static random-access memory
configuraholicLogical Unit Numberstatic scope
configuration itemlogic bombstatic typing
configuration managementLogic Design Languagestatic variable
configuration programminglogic emulatorStation Management
configureLogic for Computable FunctionsStatistical Analysis System
conflationlogic gateStatistical Package for the Social Sciences
congestionlogic programmingstatistical time division multiplexing
CONICLogic Replacement Technologystatistics
conjunctionlogic variableStatMUX
Conjunctive Normal FormLOGINSTB
connectlog inSTD
connected graphLOGISCOPESTD 1
connected subgraphLoglanSTD 13
Connection Definition LanguageLoglan'82STD 15
connectionless protocolLoglan-88STD 2
Connection Machine LISPLOGLISPSTD 9
connection-orientedLOGOstderr
connection-oriented network servicelog offstdin
connectiveLOGOLstdio
connector conspiracylogonstdio.h
CONNIVERlog outSTDM
Co-NPLojbanstdout
CONSLOLSTDWIN
consLOLITAsteam-powered
conservative evaluationLolliSteelman
considered harmfulLOMsteganography
consistently completelongitudinal paritystemmer
consoleLongitudinal Redundancy Checkstemming
console jockeyLOOKSTENSOR
consortiumLook Ahead Left-to-right parse, Rightmost-derivationSTEP
Consortium for Lexical ResearchLook ahead LRStephen Cole Kleene
constant angular velocitylook and feelStephen Jobs
constant applicative formLooking GlassStephen Kleene
constant foldingLOOKSstepper motor
Constantine/YourdonloopStepstone Corp
constant linear velocityloop combinationstepwise refinement
constant mappingloop fusionstereogram
constraintLOOPNSterling Software, Inc.
constraint functional programmingLOOPSSteve Jobs
Constraint Handling In Prologloop throughSteve's Shell
ConstraintLisploose bytesSteve Wozniak
Constraint Logic ProgrammingLOPSTFT
CONSTRAINTSlord high fixerSTFU
constraint satisfactionLoreSTFW
constructed typeLorem ipsumSticks&Stones
Constructive Cost ModelLorenz attractorsticky analysis
constructive proofLORIAsticky bit
constructive solid geometrylosesticky content
constructorloserstiffy
ConsullosingSTIL
consultantlossSTING
container classlossageSTk
content addressable memorylosslessSTMP
content-based information retrievallossless audio compressionstochastic
Content Data ModelLossless Predictive Audio Compressionstock-keeping unit
content-freelossySTOIC
contention slotlossy audio compressionstomp on
Contents of Decrement part of Registerlost in the noiseSTONE
contextlost in the underflowStone Age
context clashLOTISstone knives and bearskins
COntext Dependent Information LanguageLOTOSStoneman
context-freelots of MIPS but no I/Ostop bit
context-sensitive menuLotus 1-2-3stoppage
context switchLotus Development Corporationstorage
Contextually Communicating Sequential ProcessesLotus NotesStorage Allocation and Coding Program
continental driftLotus Notes Formula LanguageStorage Area Network
continuationLotusScriptStorage Management Services
Continuation Passing Styleloudspeakerstorage media
continuation passing styleLoutstore
continuationslovestore and forward
continuous functionlow-bandwidthstored procedure
Continuous System Modeling ProgramLow Bandwidth Xstorm
Continuous System Simulation Languagelow earth orbitStory of Mel
continuous waveLower Layer ProtocolSTP
contractionlower setStP
contract programmerLow Insertion ForceSTP4
controlLOWLStrachey, Christopher
Control and Status Registerlow-level languageStrand
control buslow pass filterStrand88
control-CLow Voltage DifferentialStratus
control codeLPACStrawman
control flowLPCSTREAM
control-GLPFstream
Control LanguageLPGstreaming
controllerLPIStreaming SIMD Extensions
control-OLPLstream-oriented
Control ProgramlpmSTREAMS
Control Program for MicrocomputersLP MUDstrength reduction
control-QlprSTRESS
control-SLPSstress testing
control structurelp spoolerstrict
control ttyLPTstrict evaluation
control unitlrstrided
conventional memoryLRCstring
converged networkLRLTRANString EXpression Interpreter
Convergent TechnologiesLRUstringly typed
Convergent Technologies Operating SystemlsSTring Oriented Interactive Compiler
Conversational LISPLSAString Oriented Symbolic Language
Conversational Monitor SystemLSBString PRocessING language
converseLSEstring reduction
conversion to iterationLSLstripe
CONVERTLSMLstripe set
convert.f90L-Softstriping
Convex Computer CorporationLSPSTROBES
convex hullLSRstroke
Conway, John HortonLSSDStrongARM
Conway's LawLSYDstrongly connected component
Conway's Lifeltstrongly typed
cooCLT-2strong typing
cooccurrence matrixLTLStroustrup, Bjarne
cookbookLTPSstruct
cooked modeLTRstructural recursion
cookieLTR3structured analysis
cookie bearluStructured Analysis and Design Technique
cookie fileLU6.2structured design
cookie jarlubstructure diagram
cookie monsterLubarsky's Law of Cybernetic Entomologystructured language
cookyLucent Technologiesstructured programming
COOLLUCIDStructured Query Language
CooLLucid EmacsStructure of Management Information
COOL:GenLucindastrudel
Co-operative Development EnvironmentLucySTRUDL
Cooperative Information SystemLUGSTSC APL
cooperative multitaskingluminancestub
coordinatelump uncurryingstub network
Coordinated Universal TimeLUNstubroutine
Coordinating Committee for Intercontinental Research Networkslunatic fringeSTUDENT
coordination languageLund SimulaStudent PL/I
copious free timeLund Software House ABstudly
copperlurkstudlycaps
Copper Distributed Data InterfacelurkerStuffit
coprocessorlurkingStupids
copy and pasteluserstupid-sort
copybookLuser Attitude Re-adjustment ToolSturgeon's Law
copybrokeLUSTRESTX
copying garbage collectionlvstyle
copyleftlvaluesu
copy memberLVDSUB
copy moduleLWPsubband encoding
copy protectionlysubclass
copyrightLYaPASsubject
copyright symbolLycossubject index
copywrongedlylafklcsubject-oriented programming
CORALlynixsublanguage
CORAL 66LYNXsubnet
CORBALynxsubnet address
CORBIELynxOSsubnet mask
CORCLynx Real-Time Systemssubnet number
coreLYRICsubroutine
core cancerLZ77 compressionsubscribe
core dumpLZ78 compressionSubscriber Identity Module
core gatewayLZ compressionsubscribing
Corel Corporationlzexe\subseteq
core leaklzhSubset-Equational Language
Corel VENTURALZH compressionSubstitute
Core Protocol StackLZW compressionsubstrate
Core WarMsubtype
corgem2subtyping
Cornell List ProcessorM2toM3SuccessoR
Cornell Theory CenterM3successor
Cornell Universitym4sucking mud
Coroutine PascalM5Sue
Corporation for National Research Initiativesmasufficiently small
Corporation for Open SystemsMACSUGAR
Corporation for Research and Educational NetworkingMacsuicideware
CORREGATEMac-1SUIF
Correlatives and ConversionsMAC-360suit
CortexMACAsuitably small
CORTLMAC addressSuite Synthetique des Benchmarks de l'AFUU
COSMACAnalystsum
COSEMacaulaySummary Object Interchange Format
COSINEMacBinarySUMMER
cosmic raysMACDesignerSUMMER SESSION
COSSmacdinksum of products
cost control callbackMACEsum of products type
Cost Driver AttributeMachSun
Cost/Schedule Control System CriteriaMachiavelliSun-2 Workstation
COTSmachinableSun-3 Workstation
CougarmachineSun-4 Workstation
cough and diemachine codesun lounge
countmachine cycleSun Microsystems, Inc.
countableMAchine INdependent SAILSunOS
countably manymachine instructionsunspots
countedmachine languagesun-stools
counterbugmachine learningSunView
country codeMach Interface GeneratorSUNY
couplingmachoflopsSUPER
Course Author LanguageMac IISuper 7
coursewareMac IIcxSuperbrain
Coursewriter IIIMacintoshSuperBrain II
cowboyMacintosh Common Lispsuperclass
COWSELMacintosh file systemsupercombinators
CPMacintosh IIsupercompilation
CPANMacintosh IIcxsupercomputer
CParaOps5Macintosh Operating SystemSuperDrive
CPEMacintosh user interfacesuperhighway
CPGAMacintoySuperJanet
CPIMacintrashSUPERMAC
CPLMACLsuper minicomputer
CPLDMacLispSuperPaint
CPMMacMinixSuper Pascal
CP/MMac OSsuperpipelined
cpoMac OS Xsuperprogrammer
cppMac Playmatesuperscalar
cpppMacPPPsuper source quench
C preprocessorMACROSuperTalk
C Programmer's Diseasemacrosuperuser
C-Prologmacro-Super VGA
cprotomacrologySuper Video Graphics Adapter
CPSMacromediaSuper Video Graphics Adaptor
CPSRmacro preprocessorSuper Video Graphics Array
CPUMacro SAPsupervisor mode
CPU Info CentermacrotapeSupervisory Control and Data Acquisition
CPU timeMACSYMASuperZap
CPU WarsMacTCPSupplementary Ideographic Plane
CRMacXsupport
crMADsupremum
crackerMad/1Sure
crackingMadalinesurfing
crack rootMADCAPSURGE
crankMADTRANsurjection
crappletmaggotboxsurjective
CrApTeXMAGICsurrogate key
crashmagicsuspension
crash and burnmagic bulletSuzie COBOL
crawlermagic cookiesv
crawling horrormagic numberSVC
Cray instabilityMagic PaperSVG
crayolamagic smokeSVGA
crayola booksMagic Switch StorySVGA monitor
crayonMagmaSVID
Cray Research, Inc.Magma2S-Video
CRCMagmaLISPSVR4
creationismmagnetic diskSVRC
creeping eleganceMagnetic Ink Character RecognitionSVS
creeping featurismmagnetic stripeswab
creeping featuritismagnetic tapeSWAG
C-Refinemagnetic tape driveswap
CRENmagneto-optical diskswap file
CREW PRAMmagneto-optical driveswapped in
cripplewaremagnetostrictive delay lineswapped out
criptographyMAGNUMswapping
Crisis SoftwareMagritteswap space
CRISPmailSweden
crispMail Application Programming InterfaceSweetLambda
Crispy Crittersmail bombswf
critical massmailboxSwing
critical sectionmail bridgeSWI-Prolog
CRLmail exchangerSwiss Army Code
CRLFMail Exchange Recordswitch
CRMmail exploderSwitched Multimegabit Data Service
crockmail filterswitched virtual circuit
cronmail gatewayswitched virtual connection
cross-assemblermail hubswitching
cross-compilermailing listswitching hub
cross-platformmail mergeswitch statement
cross-postmail pathswizzle
cross software.mailrcSWL
CROSSTABSmail serverSWT
crosstalkMail Transfer Agentswung dash
CROW PRAMMail Transport Agentsy
CRTmail user agentSybase, Inc.
CRUDMail Users' ShellSybase SQL Server
crudwaremainSYDEL
cruftMAINBOLSYGMA
cruftedMain Distribution FrameSYLK
cruft togethermainframesyllogism
crumbmainframe programmer/analystSylvan
crunchmain loopSymantec
cruncha cruncha crunchamain memorySYMBAL
crunchyMAINSAILSymbMath
cryppiemain storeSYMBOLANG
cryptmaintainerSymbolic Assembler Program
cryptanalysismaintainer scriptSYMBOLIC ASSEMBLY
Crypt Breakers WorkbenchmaintenanceSymbolic Automatic INTegrator
cryptographyMaisiesymbolic inference
cryptologymajor deliverySymbolic Link
CrystalMajordomosymbolic link
CS-4major releasesymbolic logic
C-SchemeMakeSymbolic Mathematical Laboratory
CSCIMakedocsymbolic mathematics
C/SCSCmakefileSymbolic Optimal Assembly Program
CSCWMaker Interchange FormatSymbolic Optimum DEUCE Assembly Program
CSGMALSymbolics, Inc.
CSG-treeMalamudSymbol Manipulation Program
cshMALIsymlink
C sharpmallsymmetric
C shellmallocsymmetric key cryptography
.cshrcmalwareSymmetric LISP
CSIDMANsymmetric multiprocessing
C++SIMmansymmetric multiprocessor
CSK Corporationmanaged codeSymphony
CSK SoftwaremanagementSYMPL
CSLManagement Information BaseSYN
CSLIPManagement Information Systemsync
CSMManager of Business ApplicationsSynchronized Multimedia Integration Language
CSMA/CDManchester Autocodesynchronous
CSMPManchester encodingSynchronous Data Link Control
CSNETMandalaSynchronous Digital Hierarchy
CSOMandelbrot, BenoitSynchronous DRAM
CSPMandelbrot setSynchronous Dynamic Random Access Memory
CSP/80mandelbugSynchronous Graphics RAM
CS/PCodeMandy Rice-Davis AppliesSynchronous Graphics Random Access Memory
CSP/kmangedSynchronous idle
CS-Prologmanglesynchronous key encryption
CSPSmanglerSynchronous Optical NETwork
CSP-Smangosyncronous
CS/QCodeMANIACsynflood
CSRman pagesynonym ring
CSSMANTISsyntactic salt
CSSAmantissasyntactic sugar
CSS/IImanual testingsyntax
CSSLManufacturer Resource PlanningSyntax-Case
CSToolsManufacturers Automation Protocolsyntax directed translation
CSUManufacturing Automation ProtocolSyntax/Semantic Language
CSU/DSUmanularitysyntax tree
CSVMAOsynthesis
CTMAPSynthesizer Specification Language
CTCmapsypware
CTC++MAPISyQuest Technology, Inc.
CTCPMaplesysadmin
CTImappingsysape
CTLmarblesSysdeco Mimer AB
CTOSMarc Andreessensys-frog
ctrlmarginalSYSKEY
CTSMarginal HacksSYSLISP
CTSSMarilsysop
CTYMark 1Sysplex
CUmarketroidsysprog
cuMarkovsystem
CUAMarkov chainSystem/360
CubeMarkov modelSystem/370
cubeMarkov processSystem 5
cubingMarkowitzSystem 7.5
CUCHmark-sweep garbage collectionSystem Account Manager
Cuckoo's Eggmarkupsystem administration
CULMarlaissystem administrator
Culler-Fried SystemMarssystem analysis
CUPIDMarseille Prologsystem analyst
CUPLmarshalingsystem board
curly bracketmarshallingsystem call
currentMARSYASsystem catalog
curried functionMartianSystem Control Language
curryingMartin Marietta Laboratories MoorestownSysteme International
curseperlMARVINSystem F
cursesMarySystem International
cursorMASsystem management
cursor dipped in XMASCOTSystem Management Bus
CU-SeeMeMask Read-Only MemorySystem Management Mode
CUSIMASMSystem Management Server
cuspyMasPar Unitysystem manager
custommasqueradingsystem mangler
Customer Information Control SystemMassachusetts Institute of Technologysystem operator
Customer Information SystemsmassageSystem Product Interpreter
Customer Interaction SoftwareMassey Hopesystem programming language
Customer Relationship ManagementMassively Multiplayer Online GameSystem R
CUTMassively Multiplayer Online Role-Playing GameSystems Administrators Guild
cut and pastemastersystems analysis
cut-and-waste codemaster boot recordSystems Analysis Definition
cut a tapeMatchmakersystems analyst
cutoverMaterial Requirements PlanningSystems Application Architecture
cut-through switchingMathcadSystems Development Life Cycle
cvMathematicasystems jock
CVSMathematical Analysis without ProgrammingSystems Network Architecture
CWMathematical Analyzer, Numerical Integrator and Computersystem software
CWebMathematics in Recognizable Form Automatically Compiledsystems operator
CWIMATHLABsystems programmer
CWICMATH-MATIC or MATHMATICsystems programming
CWISmath-outsystem testing
C with ClassesMathWorkssystem unit
cxMATLABSystem V
cxrefMatrixSystem V Interface Definition
cyMatrix CompilerSystème International
Cy486SLCMATRIX MATHSystème International d'Unités
cyberMatrix Math eXtensionssystolic array
cyberbunnyMAUSysVile
cyberchondriacMauchly, John W.sz
cybercrudmawkT
CyberGlovemaximal free expression\t
cyberneticsmaximinT1
cyberpunkMAXIMOPT1 line
cyberrheamaximum Maytag modeT1 rate
cybersexmaximum seek timeT3
cyberspacemaximum segment sizeT3 line
cyberspasticMaximum Transmission UnitTA
cyber-squattingMaxis SoftwareTAA
CyberWandMBTAB
CyberZineMBASICtable
CYBILMbogo, Dr. Fredtable locking
CycMBONEtablespace
CYCLMBpsTABLET
cyclembpsTABLOG
cyclebabbleMBStab-separated values
cycle crunchMCTABSOL
cycle droughtmcTabulating Machine Company
cycle of reincarnationMC68000TAC
cycle serverMC68010TACL
cyclic redundancy checkMC68020TACPOL
cyclic redundancy codeMC68030Tactile User Interface
CycloMC68040tag
cyclomatic complexityMC6809Tagged Image File Format
Cygnus Tcl ToolsMCAtagged queueing
cylinderMCADtagged types
CypherTextMCCtag name
CyrixMcCulloch-Pitts neurontail call optimisation
Cyrix 6x86MCDBAtail call optimization
czMCDSTtail circuit
DMcG360tail recursion
D-1000MCGAtail recursion modulo cons
DAAMCItail recursion optimisation
DACMCI Mailtail-strict
DACAPOMCLTAL
DACNOSM-CodeTALE
D/A converterMCPTaligent
DACTLMCP-1600talk
DADSMCPDtalk bomb
daemonMCStalker system
DAGMCSAtalk mode
DaisyMCSDTALL
DAISY 201MCSEtall card
daisy chainmcvaxTandem Application Language
daisywheel printermcvertTandem Computers
dancing frogMDTandy
dangling pointermdTanenbaum, Andrew
DANTEMD5Tangible User Interface
DAP FortranMDAtanked
DAPLEXMDACTANSTAAFL
DAREMDCTTAO
dark-side hackerMDFTAOS
DarmsMDITAP
DARPAMDLtap
Dartmouth BASICMean Time Between Failurestape
DarwinMean Time Between Faultstape archive
DASMean Time To Recoverytape drive
DASDmeasuretape head
DASEmeasurementTape Operating System
DASLmeatspaceTAPI
DATmeatwaretar
datamediatar and feather
data abstractionMedia Access Controltarball
data acquisitionMedia Access Unittarga
Data Address GeneratorMedia ConverterTarga Graphics Adaptor
databaseMedia Gateway Control Protocoltarget
database administratorMedium Access ControlTarget-Machine Description Language
database analystmeecesTARTAN
database machineMeettaskbar
database management systemmegTask Control Block
database managermega-task scheduling
database normalisationmegabits per secondTASM
database query languagemegabyteTASS
database servermegabytes per secondtaste
database transactionmegafloptatar
Data/BASICmegaflopstau
DATABUSMegaHertztautological probability
data busmegapennytautological set
datacenter managerMEGOtautology
data channelMeiTAWK
DATACODE IMelTaxis
DatacomMELDtayste
Data Communication EquipmentMELDCtaz
data communications analystMelindaTB
Data Communications EquipmentMel KayeTBF
data compressionMellorTBIL
Data definition languagemeltdownTBK
data dictionarymember functionTbl
data dictionary filemembership functiontc
data drivenmemeT-carrier system
Data Driven Machinememe plagueTCB
Data Encryption Algorithmmemetic algorithmTCGS
Data Encryption KeymemeticsTC/IX
Data Encryption StandardMemexTcl
data feedmemo functionTcl Consortium
data flowmemoisationtcl-debug
data flow analysismemoised functionTcl-DP
Data Flow Diagrammemoizationtclhttpd
data forkmemoized functionTclX
data framememoryTCM
Data Generalmemory address spaceTCO
Data General mN601memory dumpTcode
data glovememory fartsTCOL
datagrammemory leakTCOL.Ada
data hierarchymemory locationTCP
data integritymemory managementTCPIP
Data Interchange Standards AssociationMemory Management UnitTCP/IP
Data Jackmemory mapped I/Otcsh
Datakitmemory protectionTcsim
Dataless Management Servicesmemory smashTCVN 5773
dataless management utilityMemory Type Range RegistersTCVN 6056
Data Link Connection IdentifierMEMStd
data link layerMentatTDD
data link levelMENTORTDEL
Data Link Provider InterfacemenuTDF
Data Link Switchingmenu barTDFL
data loggermenuitisTDI
data loggingMENYMA/STDM
Data Management LanguageMercury AutocodeTDMA
Data Manipulation Languagemercury delay lineTDR
data martMERISETeamwork
Datamatic CorporationMerlinTechnical/Office Protocol
DatamationMEROONTechnion
data miningMesatechnology
data modelmeshTechnology Enabled Relationship Manager
data modelingMESI protocolTechnology of Object-Oriented Languages and Systems
data modellingmessageTechRef
Data Over Cable Service Interface Specificationmessage boardTECO
Data Over Cable Systems Interface SpecificationsMessage Digest 5tee
data packetmessage digest functionTEI
Dataparallel-CMessage Handling Systemtelco
Data Parallel Haskellmessage passingTELCOMP
data pathMessage Passing InterfaceTelecommunication Display Device
Dataphone Digital Servicemessage switchingTelecommunications Device for the Deaf
DataPointMessage Transfer AgentTelecommunications Industry Association
data processingMessage Transport Agenttelecommuting
Data Protection ActMessaging Application Programming Interfaceteledildonics
data rateMessaging Applications Programming Interfacetelegraphy
data redundancymess-dostelematics
data segmentMETATelEnet
data service unitmetaTELEPAC
data setMETA 5Telephone Application Program Interface
data set organizationmeta bittelephony
DataStageMetaCardTelephony Application Programming Interface
Datastorm Technologies, Inc.Meta-CASE toolTelephony User Interface
data stripingmetaclassTelerat
data structureMeta Class SystemTelescope User Interface
Data Structures LanguageMeta-CrystalTelescript
Data Terminal EquipmentmetadataTeletype
Data Terminal ReadyMetadata Information Partnersteletype
DATA-TEXTMETA elementTeletype Corporation
data transfermetafileteletypewriter
data transfer rateMETAFONTTeleUSE
DATATRIEVEmetaheuristictelevision
Datatron 200 seriesMeta-IITelevision Interface Adaptor
data typemetainformationTELNET
DataViewsMeta-IVTelocator Alphanumeric Protocol
DataVisMETALTelon
data warehousemetalanguageTELOS
data warehousingMetal Oxide SemiconductorTELSIM
dateMetal Oxide Semiconductor Field Effect Transistortemplate
DAUmetaphonetemplate code
daughtermetaprogramtemplate wizard
daughterboardmetasyntactic variableTEMPLOG
daughtercardmetasyntaxTEMPO
David TurnerMETA tagTempo
day modeMeta-Vlisptemporal database
DAZIXMet-Englishtemporal logic
DBMETEORTempura
DB2meterTen15
DB-25methodtendinitis
DB2 catalogmethod invocationTenDRA
DBAmethodologyten-finger interface
dBASEMethodstennis elbow
DBCme tootense
DBCSmetretensor product
dBFASTmetrictenured graduate student
DBHmetric spacetera-
DBMSMetropolitan Area Networkterabyte
DBPLM-expression LISPteraflop
DBRIMFCteraflop club
dbxMFETERM
dBXLMFLOPSTERMAC
DCMFMtermcap
DC1MFTLterminak
DC2mgterminal
DC3MGCPTerminal Access Controller
DC4mhterminal adapter
DCAMHDLTerminal Adaptor
DCACMHEGterminal brain death
DCALGOLMHSterminal emulation
DCCMHzterminal emulator
DCDLMIBterminal illness
DCEMIB Variableterminal junkie
DCGMic-1terminal node
DCIMic-2Terminal Oriented Real Time Operating System
DCLMICETerminal Oriented Social Science
DCOMmiceTerminal Productivity eXecutive
DCPMichigan Algorithm Decoderterminal server
D. C. Power LabmickeyTerminal User Interface
DCSmickey mouse programTerminate and Stay Resident
DCTMICRtermination analysis
DDmicroterminator
ddmicro-term rewriting system
DDBmicroarrayTerms Of Service
DDCMPMicro Assembly Languageternary
DDEmicrocenturyterpri
DDE ManagerMicro Channel Architectureterrabyte
DDIFmicrochip artTerse
DDLmicrocodetest
DDMMicrocom Networking Protocoltest coverage
DDNmicrocomputertest-driven development
DDOmicrocontrollertesting
DDPMicroDroidTET
DDRmicroelectromechanical systemTeX
DDR-RAMMicroelectronics and Computer Technology CorporationTeX-78
DDR-SDRAMMicroEmacsTeX-82
DDSmicrofloppiesTexas Instruments
DDTmicrofortnightTexinfo
DDWMicroGnuEmacsTeX point
deMicro Instrumentation and Telemetry Systemstext
DE-9Micro Interpreter for Knowledge Engineeringtext-based
DEAmicrokerneltext editor
DEACONmicroLenatText Encoding Initiative
deadmicrologtext file
DEADBEEFmicrometreText Processing Utility
dead codeMicro MLText Reckoning And Compiling
deadlockMicrontext segment
deadly embracemicronText To Speech
dead treeMicron Electronics, Inc.Textual User Interface
dead tree editionMicronetics Standard MUMPStexture
deamonMicro$ofttf
death codemicroperationTFDL
Death StarmicrophoneTFT
debmicroPLANNERTFTP
Debbugsmicroprocesortg
DebianmicroprocessorTGA
Debian GNU/HurdMicroprocessor without Interlocked Pipeline StagesT-gen
Debian GNU/LinuxmicroprogrammingTGS-II
debianizemicroReidTGS Systems
deboursificationMICRO SAINTtgz
De Bruijn graphmicrosecondth
De Bruijn notationMicroserfthanks in advance
DEBUGMicroslopThat's not a bug, that's a feature!
debuggerMicrosloth WindowsT.H.E
debuggingMicrosoftThe Cuckoo's Egg
debugging an empty fileMicrosoft AccessThe Dojo Toolkit
debugging by printfMicrosoft BasicThe Force
debugging toolMicrosoft Certified Application DeveloperThe Internet Account
DECMicrosoft Certified Database AdministratorThe MathWorks, Inc.
decMicrosoft Certified Desktop Support TechnicianThe Metadata Company
DEC AlphaMicrosoft Certified Professional DeveloperThe Microsoft Network
decayMicrosoft Certified Solution DeveloperThe Mythical Man-Month
DECdesignMicrosoft Certified System EngineerThe Network
DECdnsMicrosoft Certified Systems AdministratorTHEO
DECheadMicrosoft Certified Systems Developertheology
dechunkerMicrosoft CorporationThe Open Group
decidabilityMicrosoft Data Access Componentstheory
decidableMicrosoft Disc Operating Systemtheory change
decimal pointMicrosoft Disk Operating SystemThe Real-Time Operating System Nucleus
decision problemMicrosoft DOSThere's More Than One Way To Do It
decision supportMicrosoft ExcelTheseus
decision support databaseMicrosoft ExchangeThe story of Mel
Decision Support SystemsMicrosoft ExtendedThe story of Mel, a Real Programmer
decision theoryMicrosoft Foundation ClassesThe World Of Cryton
deckleMicrosoft IISthe X that can be Y is not the true X
declarative languageMicrosoft IntelliMouse Explorerthicket
DECmate IMicrosoft Internet Information Serverthick Ethernet cable
DECnetMicrosoft Mailthick film dielectric electroluminescence
decodeMicrosoft Mail Application Program Interfacethicknet
Decomposed Petri NetMicrosoft Networkthin client
decompressMicrosoft Networkingthin Ethernet cable
decryptionMicrosoft OfficeThingLab
DECstationMicrosoft Office Small Business EditionThink C
DECTMicrosoft Point to Point EncryptionThinking Machines Corporation
DECtapeMicrosoft Projectthinko
DECUSMicrosoft SQL Serverthinnet
Decus cppMicrosoft Windowsthird generation computer
DEC WarsMicrosoft Wordthird generation language
DECwindowsMicroStationthird normal form
DECwritemicrotapeThis can't happen
DEDMicroware Corporationthis dictionary
dedicated lineMicrowave Hardware Description LanguageThis time, for sure!
deductive databaseMIDASthn
deductive tableauMidasThomas
Deep BlueMidas-WWWthrash
deep hack modemiddle-endianthrashing
deep magicmiddlewarethread
deep spaceMIDIthreaded
de facto standardmid-level networkthreaded code
defaultMIFthreading
default.htmMIGThread Language Zero
default routeMIGRAINESthread-safe
defectMIIthree-finger salute
defect analysisMIISthree-letter acronym
defect densityMIKEthree-tier
Defense Advanced Research Project Agencymilthroughput
Defense Advanced Research Projects AgencyMilarepathud
Defense CalculatorMILITRANThumb
Defense Communications Agencymillthumb
Defense Data Networkmillennium bugthumbnail
Defense Data Network Network Information Centermillennium meltdownThunderbird
Defense Information Systems Agencymilli-thunk
Defense Trade RegulationsmillihelenTIA
deferralmilliLampsontick
definite clausemillisecondTickIT
definite sentenceMILNETTickle
definitional constraint programmingMIMDtickle a bug
deflateMIMEtick-list features
deflate compressionmimencodeTIFF
deflate/inflate compressionMimer SQLtiger team
deforestationMIME typetight loop
defragMIMICtilde
defragmentMIMOLATILE Forth
defunct processmind mouseTim Berners-Lee
degreemind uploadingtime bomb
degrees of freedomMinerva softwaretime complexity
dehoseMinesweeper, Chess, Solitaire ExpertTime Complex Simulator
DEKminicomputertime division multiple access
Delaunay triangulationMini Disctime division multiplexing
delayed control-transferminifloppyTime Domain Reflectometer
delay instructionminimal automatontimeout
delay slotminimaxtime quantum
deleteMini-MLtime-sharing
delimiterminimum seek timeTime Sharing Option
delintMini PL/Itime shifting
DeliriumMINITAB IITime Simulator
Delivered Source InstructionMINIXtime sink
Dell Computer CorporationMinnesota Internet Users Essential Tooltime slice
DelphiMINTtimes-or-divided-by
Delphi TechniqueMiNTtime T
DeltaMint Is Not TRACTime to Live
deltaMinuettime zone
Delta-4MINUITTINC
delta conversionminusTinman
Delta-Prologminus infinitytinman+
delta reductionMIPSTINT
DELTASEMIPS projecttint
demand drivenMIPS R2000Tiny
demand pagedMIPS R2010Tiny BASIC
demand pagingMIPS R3000Tiny Basic Interpreter Language
DeMarcoMIPS R4000Tiny Clos
DeMarco/YourdonMIPS Technologies, Inc.TIP
dementedMiraculaTIPL
DemeterMirandatip of the ice-cube
demigodMIRFACtired iron
De-Militarised Zonemirrortits on a keyboard
demomirroringtj
demodulatemirror siteTk
demodulationMIStk
demo modemisbugTK-90X
demonMIS DirectorTK-95
Demon Internet Ltd.misfeatureT. Kohonen
DeMorgan's theoremMISHAPTK!Solver
demo versionMissed'em-fiveTL0
Denis Howemissile addressTL1
Dennis RitchiemissingTLA
denotational semanticsmiswartTLAs
Denotational Semantics LanguageMITTLB
Department of DefenseMIT AI LabTLD
Department of Defense NetworkMITITLI
depeditateMITILACTL/I
dependabilityMIT Lisp MachineT Lisp
dependable softwareMITRE CorporationTLS
Deployment DescriptorMIT Research Laboratory for ElectronicsTM
deprecatedMITStm
depth-first searchMIT Scheme(TM)
dequeMIXTMDL
dequeueMIXALTMG
DERMIX CommunicationsTMRC
dereferenceM-JPEGTMRCie
de-rezzMJSTMS 9900
derived classmktn
derived typeMLtn3270
DESmlTNC
descenderML-2000TNSTAAFL
descent functionMLABTNX
Descriptive Intermediate Attributed Notation for AdaML/ITNXE6
Descriptive Top-Level SpecificationMLISPto
descriptorML Kitto a first approximation
designMLLtoast
Design In Real TimeML-lextoaster
design patternML-Lindatoasternet
design recoveryML Threadsto a zeroth approximation
Design System languageML-Twigtoggle
desk checkmmTOK
desktopMmatoken
desktop databasemmaptoken bus
Desktop Management InterfaceMMCDtoken ring
Desktop Management Task ForceMMDFTomeRaider
desktop managerMMITom Knight
desktop publisherMMLtone
desktop publishingMMOTony Hoare
DESQviewMMOGtool
destructorMMORPGtoolbar
DESYMMStoolbook
DETABMMUToolbuilder
deterministicMMXTool Builder Kit
deterministic automatonMMX technologyTool Command Language
DETOLmnTOOLS
developermnemonictoolsmith
developmentMNPTOP
Developmental Test and Evaluationmotop-down design
development environmentMobile Subscriber Integrated Services Directory NumberTop-Down Model
deviceMobile Tritontopic drift
Device Controlmobotopic group
Device Control 1MOBSSL-UAFtopic map
Device Control 2mobytopic thread
Device Control 3mockingbirdtop-level domain
Device Control 4Mockingboardtopology
device driverMock LispTOPS-10
device independent bitmapmodTOPS-20
Device Manager*MODTornado
Devil BookmodalToronto Euclid
/dev/nullmodal logictorrent
devomodamTORTOS
DEXMODCALTOS
DFAModeToshiba Corporation
DFCmodeTOSS
DFDmode bittotal function
DFSMODEFtotally ordered
DFTMODELtotally ordered set
DGLmodeltotal ordering
DG/Lmodel checkingtoto
DHCPmodelingtouchpad
Dhrystonemodeling languagetouch screen
DHSDmodellingtourist
DHTMLmodelling languagetourist information
Dialled Number Identification ServiceModelsimTowers of Hanoi
DIALOGModel View ControllerTower Technology Corporation
dialupmodemtoy
DIAMAGMODEM7Toy/Ada
diametermoderatortoy language
DiamondModified Frequency ModulationToyohashi University Parallel Lisp Environment
DIANAmodifiertoy problem
DIBM O drivetoy program
DIBOLMODSIMtp
dickless workstationMODSIM IITPA
Dick Size WarModulaTPF
DICOMModula-2TP/IX
dictionaryModula-2*TPL
Dictionary APLModula-2+TPO
dictionary flameModula-3TPS
Dictionary of Algorithms and Data StructuresModula-3*tptc
Dictionary of ComputingModula-3piTPU
DIDModula-PTPX
diddleModula-Prologtr
Didot pointModula/RTRAC
diemodular arithmetictraceroute
die horriblyModular Ctrace scheduling
diffMODUlar LAnguagetrack
Difference EngineModular Prologtrack ball
difference equationModular SB-Prologtracker ball
differential backupmoduletracking
differential driverModulextracking cookie
differential linemodulotracking file
Diffie-Hellmanmodulo arithmetictrackpad
digeratimodulo operatorTrackPoint
digestMohammed Al-Khawarizmitractor feed
Digexmolly-guardTrafoLa
DigiCashmonadTrafola-H
Digicommonadictrampoline
digiratiMongolian Hordes techniqueTRANDIR
digitmoniterTRANQUIL
DigitalmonitorTRANS
digitalmonkey, scratchtransaction
digital audiomonkey sortTransaction Application Language
Digital Audio Tapemonkey upTransaction Processing Facility
digital cameraMonotransceiver
digital carriermonochromeTRANSCODE
digital certificateMonochrome Display Adaptertransducer
digital computermonoidtransfer
Digital Control Systemmonotonictransfer none
digital dashboardMONSTRtransfer of control
Digital Data ServiceMontagetransfer rate
digital electronicsMonte Carlotransfer syntax
Digital Enhanced Cordless Telecommunicationsmontytransfinite induction
digital envelopeMOOtransformation
Digital Equipment Computer Users SocietyMooftransient
Digital Equipment CorporationMoore boundTransient Program Area
Digital Equipment Corporation NetworkMoore graphtransistor
Digital European Cordless TelecommunicationsMoore's LawTransistor-Transistor Logic
Digital Express Group, Inc.moose callTRANSIT
Digital Lempel Ziv 1MooZtransition ad
Digital Library InitiativeMopstransitive
Digital Linear TapeMORALtransitive closure
digital logicmoretransit network
Digital MultimetermoriaTranslation Look-aside Buffer
Digital Radio MondialemorphingTransmission Control Protocol
Digital ResearchMorse codetransparent
Digital Rights ManagementMORTRANtransparent audio coding
digital service unitMOSTransport Driver Interface
Digital Signal ProcessingMosaictransport layer
Digital Signal Processing LanguageMosaic Communications CorporationTransport Layer Interface
digital signatureMoscow MLTransport Layer Security protocol
digital signaturesMOSFETTransport Level Interface
Digital Signature StandardMosiacTransport Service Access Point
Digital Simulation LanguageMOS Technologiestransputer
Digital Simultaneous Voice and DataMOS TechnologyTRANS-USE
DIGITAL Standard MUMPSmost general unifiertrap
Digital Subscriber LineMost Significant Bittrap door
Digital Subscriber Line Access Modulemotdtrap-door function
Digital Subscriber Loopmothertrash
Digital Switched NetworkmotherboardTrash-80
Digital to Analog ConverterMotiftraveling salesman problem
Digital Versatile DiscMotion JPEGtravelling salesman
Digital Versatile Disk Random Access MemoryMotion Picture Experts Grouptravelling salesman problem
Digital Video DiscMotorolatraversal
Dijkstra's guarded command languageMotorola 14500Btraverse
dikeMotorola 6800trawl
DILMotorola 68000tree
DilbertMotorola 6801tree-killer
DilbertedMotorola 68010TREET
DIMMotorola 68020TREETRAN
DIMATEMotorola 68030Tree Transformation Language
DIMMMotorola 68040treeware
DIM statementMotorola 68050Trellis
DINMotorola 68060Trellis Code Modulation
DIN-8Motorola 6809Trident
dingMotorola 680x0trigger
Dining Philosophers ProblemMotorola 68HC11trigger finger
dinkMotorola 68LC040TRIGMAN
DinnerBellMotorola 88000trillion
DINOMotorola, Inc.Trilogy
dinosaurmounttriple DES
dinosaur penMousetri state
dinosaurs matingmousetrit
diodemouse aheadTriton
Diophantine equationmouse aroundTriton II
DIPmouse arrestTriton VX
diplexmouse beltTrivial File Transfer Protocol
DIPPmouse droppingsTRO
Direct-Access Storage Devicemouse elbowtroff
Direct Client to Client Protocolmouse mattroglodyte
Direct Connectionmouse padtroglodyte mode
directed acyclic graphmouse trailstrojan
directed graphmousoTrojan horse
Directed OcMoving JPEGTROLL
directed setMoving Picture Expert Grouptroll
Direct Inward DialingMoving Picture Experts GroupTRON
directional couplerMoving Pictures Experts Grouptron
Directly Executable Test Oriented LanguageMoxieTrouble Came Back
direct mapped cacheMozillaTRS
Direct Memory AccessMozilla FoundationTRS-80
directoriesMozilla Public LicenseTruchet point
directorympTrue BASIC
Directory Access ProtocolMP1true colour
directory serviceMP-1true hacker
Directory System AgentMP2TRUENAME
Directory User AgentMP3TrueType
DirectXMP3ProTrumpet
DIRFTMPCTRUSIX
DirtMPC Level 1 Specificationtruth table
dirtballMPC Level 2 SpecificationTS
dirty powerMPEGTSAP
disMPEG-1TSEE
DISAMPEG-1 audio layer 1TSIA
disaster planningMPEG-1 audio layer 3Tsim
disaster recoveryMPEG-1 layer 3TSL-1
discMPEG-2TSO
disc driveMPEG-21TSP
disclaimerMPEG-2.5 audio layer 3TSR
disconnectMPEG-2 AAC Low ProfileTSV
DiscordianismMPEG-2 audio layer 3tt
discreteMPEG-2 Low Sampling Frequencies ExtentionTTD
discrete cosine transformMPEG-2 LSFTTFN
discrete Fourier transformMPEG-2 MCTTL
discrete preorderMPEG-2 Multi Channel ExtentionTTS
discriminated unionMPEG-3tty
discussion groupMPEG-4TTYL
DisipleMPEG-4 AAC Main ProfileTUB
disjoint unionMPEG-4 AAC SSRTUBA
Disjunctive Normal FormMPEG-4 Advanced Audio Coding Scalable Sampling Ratetube
diskMPEG-4 Harmonics, individual lines and noisetube time
disk controllerMPEG-4 Harmonic Vector eXCitationTuckals
disk driveMPEG-4 HILNTUI
disk duplexingMPEG-4 HVXCTukey, John
disketteMPEG-7Tuki
disk farmMPEGplustunafish
diskless workstationMPGtune
disk mirroringmpgtunneling
Disk Operating SystemMPItunnelling
disk operating systemMPLTunny Emulator
disksMPL IITUPLE
disk stripingMPLStuple
DislangMPLS domaintuple calculus
dismanMP/MTuple Space Smalltalk
displayMPPtupling
display hackMPPETurbo C
Display PostScriptMPPLTurbo C++
Display Screen EquipmentMPR IITurbo Debugger
display standardM-Prologturbo nerd
display standardsMPS IIITurbo Pascal
display terminalMPSXTurbo Prolog
Dissociated PressMPVTuring
distfixMPXTuring Machine
Distributed Component Object ModelmqTuringol
Distributed Computing EnvironmentMQGTuring Plus
distributed databasemrTuring tar-pit
Distributed Data ManagementMRAMTuring test
distributed data warehouseMRDAturist
Distributed EiffelMRDSTURN
Distributed Logic ProgrammingMRIturn-key
Distributed Management EnvironmentMROCturtle graphics
distributed memoryMROMTUTOR
Distributed Network Operating SystemMRPTuxedo
Distributed Operating Multi Access Interactive NetworkMRP IITV
Distributed ProcessesMRStv
Distributed Queue Dual Busmstw
Distributed SmalltalkMS AccessTWAIN
distributed systemMSAUtweak
distributed systemsMSBtweening
distributionMS-BASICtweeter
distributive latticeMS-DOGTWENEX
disuseredMS-DOSTwente Compiler Generator System
ditheringMSG.84Twentel
Ditto DrivemsgGUItwiddle
divergeMSIETWIG
divisorMSMtwilight zone
djMS Mailtwink
DJGPPMSNtwinning
DjVuMS OfficeTwin Vector Quantization
DKMS Projecttwip
dkMSStwirling baton
DL/1MS-Windowstwisted pair
DLCMswLogotwisted pair only
DLCIMS WordTwitter
DLEMSXtwm
DLGMSX-DOS.twmrc
DL/Imttwo-binary, one-quaternary
DLLMTAtwonkie
DLMMTBFtwo-phase commit
DLPmtctwos complement
DLPIM Technology Associationtwo-to-the-N
DLSwMTOStwo-valued logic
DLTMTSTX-0
DLUR/DLUSMTTRTXL
DLZ1MTUTYMCOM-X
dmMuTYMNET
DMAmuTymshare, Inc.
DMADMUAtype
dmakeMUCALtype-ahead
DMALGOLMUDtype-ahead search
DMEmuddietype assignment
DMIMuddletype class
DMLmudheadtyped lambda-calculus
DMMMUD Object OrientedTypedProlog
DMSmuFPtypeface
DMTFMuhammad al-Khwarizmitype inference
DMUMuhammad ibn Musa al-Khwarizmitype scheme
DMZmu-lawtypo
DNA computingMuletypographical error
DNFMul-TTYPOL
DNISMulti-BinPrologtypo squatter
DNIXmultiboottyt
DNOSmultiCTZ
DNSMultiCal Systemtz
domulticast addressingua
DOAmulticast backboneUAN
DocMulti-channel Memorandum Distribution FacilityUART
docmulticianUAT
docking stationMulti-Color Graphics ArrayUAW
DOCMakerMulticsUBASIC
docoMultics Relational Data StoreUBD
DOCSISMultiflow Computerubiquitous computing
doctype decorationMulti-GarnetuC++
documentmultihomed hostUCB
documentationmultilayer perceptronUCHO
Document ExaminerMultiLispU-Code
Document Image ProcessingmultimediaUCP
Document Object ModelMultimedia and Hypermedia information coding Expert GroupUCS
Document Style Semantics and Specification LanguageMultiMedia Compact DiscUCSD Pascal
Document Type DefinitionMultiMedia ExtensionUCS transformation format
DOCUSMultimedia Integrated Conferencing for European ResearchersUCX
DoDMultimedia Internet Mail Extensionsudb
DoD-1Multimedia Messaging ServicesUDDI
dodgyMultimedia PCUDF
DOD-STD-2167AMultimedia Personal ComputerUDMA
DoD-STD-2168multimedia systemUDP
DOEmulti-part keyuemacs
DOFMulti-PascalUFO
dogmultiple accessUFO bug
dogcowMultiple Access with Colision Avoidanceug
dogfoodmultiple bootUGLIAC
dogfoodingMultiple Document InterfaceUHELP
dogpilemultiple inheritanceUI
dogwashMultiple Instruction Multiple Datauid
Do It Right the First TimeMultiple Instruction/Multiple DataUIDL
DojoMultiple MasterUIL
DOLmultiple perspective software developmentUIMS
dollarmultiple valueUIMX
do loopMultiple Virtual StorageUIS
DOMmultiplexeruk
domainmultiplexingUKC
domain addressmultiplexorUKERNA
Domain AnalysisMultiplexor ChannelUKUUG Ltd.
domain architecturemultiplex printerULCC
Domain Architecture ModelMultipop-68Ulm's Modula-2 System
domain calculusmultiprocessingULP
domain engineeringmultiprocessorUltra64
domain handlemultiprogrammingUltra-ATA
domainistMultiprotocol Label SwitchingUltra DMA
domain maturityMultipurpose Internet Mail ExtensionsUltra-SCSI
domain modelmultiscanUltrix
domain nameMultiSchemeum
Domain Name ServerMultistation Access UnitUMB
Domain Name SystemmultisyncUMB Scheme
domain selectionMultisystem eXtention Interface BusUMDL
Domain Software Engineering EnvironmentmultitaskingUML
domain-specific languageMulti-tasking Program for MicrocomputersuML
domain squattermultithreadedUMTS
domain theorymultithreadingunary
Domestic Communications Assistance CenterMultiTOSUNC
DOMFmulti-userUNCL
Donald KnuthMulti-User DimensionUNCOL
dongleMulti-User Dungeonuncompression
dongle crackerMulti-User Shared Hallucinationuncountable
dongle-diskMulti-Version Concurrency Controluncurry
Don't do that then!multi-way branchuncurrying
donutsMuMathundefined
Doocedmumblageundefined external reference
DOOMmumbleunderflow
DOORSmumble modeUndernet
doorstopMUMPSunderscore
Dorito Syndromemunchunder the hood
DORUMmunchingundocumented feature
DOSmunching squaresU-NET Limited
DOS/360munchkinunfold
DOS Protected Mode Interfacemundaneunfold/fold
DOS requestermungUNI
dotmungeunicast
dot addressMUPUnicode
dot comMU-PrologUniCOMAL
dot fileMurphy's LawUnicorny
dot leadersMuseunicos
dot matrix printermuseumUniface
dot notationMUSHunification
dot pitchMusicUnified Han
dotted quadMusical Instrument Digital InterfaceUnified Modeling Language
double buckyMusicamunifier
double-clickMuSimpUNIFORM
Double Data Rate Random Access MemoryMUSLUniform Naming Convention
Double Data Rate Synchronous Random Access MemorymutantUniform Resource Citation
double DECkersMutation TestingUniform Resource Locater
double densityMuTeXUniform Resource Locator
doubled sigmutexUniform Resource Name
double-duplexmutterUniform Resource Number
double-ended queuemutual exclusionUnify
double quotemutually recursiveunify
doubly linked listmutual recursionUnify Corporation
DOUGLASmuxUnihan
Douglas Engelbartmvuninstaller
Doug LenatMVCuninteresting
DOW COMPILERMVCCUninterruptible Power Supply
Do What the Fuck You Want to Public LicenseMVSunion
downMVS/ESAUnipalm Group plc
downloadMVS/OEUnipress Software, Inc.
downloadingMVS/Open Editionuniprocessor
downsizingMVS/SPUNIQUE
downstreamMVS/XAUnique ID Listing
down-timemwunique key
downward closedMXunique sales point
Downy cocktailmxUnir Tech
DPMXIUNISAP
DPAMXIbusUnisys Corporation
DPBMX RecordUnited Kingdom Unix Users Group
DPermyUnited Technologies Research Cente
dpiMy Favourite Toy LanguageUnit Separator
DPLMYOBunit testing
DPL-82MySpaceUNITY
DPLLMySQLUnivac
DPMIMySQL ABUniversal algebra
DPMSMYSTICUniversal Asynchronous Receiver/Transmitter
DPNMZUniversal Character Set
DPPmzUniversal Communications X
d-PrologNUniversal Computer Protocol
DPSN10Universal Debugger
DPS-6naUniversal Description, Discovery, and Integration
dpSathernadgerUniversal Disk Format
DPSKNAGUniversal Naming Convention
DQDBNagling Coalescenceuniversal quantifier
draconagwareUniversal Resource Identifier
Draft Once ReUse Manynailed to the wallUniversal Resource Locator
dragnailing jellyUniversal Serial Bus
drag and dropnaiveuniversal thunk
draggingnaive userUniversal Time
drag-n-dropNAKUniversal Time Coordinated
DRAGONname captureuniverse of discourse
dragonnamedUniversity of Arizona
Dragon Booknamed pipeUniversity of California at Berkeley
DRAGOONname resolutionUniversity of Durham
drainname service switchingUniversity of East London
DRAMnamespaceUniversity of Edinburgh
DRAM refreshnaming conventionUniversity of Hawaii
Drawing eXchange FormatNaNUniversity of Iceland
dread high bit diseaseNANDUniversity of London Computing Centre
DREAM 6800nano-University of Michigan
DRECNETnanoacreUniversity of Michigan Digital Library Project
drill downnanobotUniversity of Minnesota
drill-down analysisnanocomputerUniversity of Nijmegen
drivenanofortnightUniversity of Pennsylvania
drivernanometreUniversity of Tasmania
driversnanosecondUniversity of Twente
Dr. James H. ClarknanotechnologyUnix
DRMNapierUnix box
droidNAPLPSUnix brain damage
DROOLNAPSSUnix conspiracy
drool-proof papernarrowbandUnix International
drop cablenarrowingUnixism
drop-down listNASUnix man page
drop-down menunasal demonsUnix manual page
drop-insNASIUnix System V
drop on the floornastisticalUnix to Unix Copy
drop-outsNASTRANUnixWare
DrSchemenastygramUnix weenie
DRUCO INATUnix wizard
druggedNathan HaleUnlicense
drug reportNational Advanced Systemsunnormalised
drumNational Bureau of Standardsunproto
drunk mouse syndromeNational Center for Supercomputing Applicationsunshar
dry runnational charactersunshielded twisted pair
DS0National Database Languageunswizzle
DS1National Information Infrastructureuntil
DS1CNational Information Services and Systemsuntyped
DS2National Institute of Standards and Technologyunwind-protect
DS3National Research and Education Networkunwind the stack
DSANational Science FoundationUN*X
DSDMNational Science Foundation Networkunzip
DSENational Semiconductorup
DSEENational Semiconductor 32000uparrow
D-shell connectorNational Software Reuse Directory\uparrow
DSINational Spatial Data InfrastructureUPenn
DSLNational Television Standards Committeeupgradability
DSLAMnative compilerupgrade
DS levelNative Language Systemupgradeability
DSMNATURALupload
DSNnatural deductionUPMAIL Tricia Prolog
DSONatural Englishupper bound
DSORGnatural languageUpper Layer Protocol
DSPNatural Language Information Analysis Methodupper memory block
DSP32 Assembly Languagenatural language processingUpper Side-Band modulation
DSP56000natural numberUpright Database Technology AB
DSP56001natureUPS
dsp56165-gccNAUupstream
dsp56k-gccnav barupthread
DSP/Cnavigatingupward closure
DSPLnavigationUranus
DSRnavigation barurban legend
DSSNavigatorURC
DSSSLNawkurchin
DSTNBURI
DSUNBFCPURL
DSVDNBSURL forwarding
DSWNBTURL redirection
DTALGOLNCURN
DTDncURouLette
DTENCDUS
DT&ENCPus
DTLSNCR Corporationusability
DTMFNCRLUSAModSim
DTPNCR Languageusa.net
DTRNCSUS-ASCII
DTSNCSAUSB
DTSSNDUSB 2.0
D-typeNDISUSB Adapter Card Support
D-type flip-flopNDLUSB drive
duNDSUSE
DUAneUsenet
dualneat hackUsenet news
DUAL-607neats vs. scruffiesUsenetter
dual-attachedNebulaUSENIX
dual bootNECuser
dual-homedNEC 780-Cuser acceptance testing
Dual In-Lineneeds assessmentuser base
Dual In-line Memory Moduleneep-neepUser Brain Damage
Dual In-Line Packagenegation by failureUser Datagram Protocol
dual portednegative acknowledgementuser-friendly
dual-stackneighborhood bike codeuser id
Dual Tone Multi FrequencyNELIACuser identifier
duck typingNeonuser interface
DUELneophiliauser interface copyright
duffNeptuneUser Interface Language
Duff's devicenerduser name
dumbed downNerd prideUser Network Interface
dumb terminalNERECOuser-obsequious
dumpNESLuser-unctuous
dumpster divingnested classUse the Source Luke
DungeonnetUSG Unix
dup killer.NETusim
duplexnet.-USL
Duplex High Speed DatanetaddressUSP
dup loopNetBEUIUSR
DurraNetBIOSusr
dusty deckNetBIOS Frames Control ProtocolUS Robotics
DV cartridgeNetBios over TCP/IPU.S. Robotics, Inc.
DVDNetBOLLIXUSSA
DVD-RNetBSDUTC
DVD-RAMnetbuiUTF
DVD-ROMnetburpUTF-8
DVInetCDFutility
DvorakNetcom On-line Communication Services, Inc.utility-coder
Dwarf Storage Unitnetdeadutility program
DWDMNetfindutility software
dweeb.NET frameworkUTOPIST
dwgnet.godUTP
DWIMNetHackUTRC
DX4netiquetteUTSL
DXFNETLuucp
dyadicnetlagUUCPNET
Dyadic Systems LimitedNetLingouudecode
Dyalog APLnetloaduuencode
Dyalog LimitedNetmarq LimitedUUNET PIPEX
DYANAnetmaskUUPC
DylanNetNannyuy
Dylperlnetnewsuz
dynamic adaptive routingnet.personalityV
Dynamic Address TranslationnetpipesV.10
Dynamically Linked Librarynet.policeV.11
dynamically scopednetquetteV.17
dynamically typedNetrekV.21
dynamic analysisnetrockV.22
dynamic bindingNetscapeV.22bis
dynamic database management systemNetscape Communications CorporationV.23
Dynamic Data ExchangeNetscape NavigatorV.24
Dynamic Data LinkingNetscape Public LicenseV.25
dynamic DBMSnetsplitV.25 bis
Dynamic Drive OverlaynetstatV.27 ter
Dynamic ExecutionnetterV.28
Dynamic Host Configuration ProtocolNetWareV.29
Dynamic HTMLNetWare Core ProtocolV.32
DYnamic LANguageNetware Directory ServicesV.32bis
dynamic linkNetware Input/Output SubsystemV.32ter
dynamic link libraryNetWare Link State ProtocolV.34
Dynamic Object-Oriented Requirements SystemnetworkV.35
dynamic RAMnetwork addressV.42
dynamic random-access memoryNetwork Addressable UnitV.42bis
dynamic routingNetwork Address TranslationV.90
DYnamics ANAlyzerNetwork Address TranslatorV.91
dynamic scopeNetwork Administratorva
dynamic scopingNetwork Application Supportvacuum tube
Dynamic Systems Development MethodNetwork Attached Storagevadding
dynamic translationnetwork byte orderVAL
dynamic typingnetwork cardValencia Simple Tasker
DYNAMOnetwork closetvalency
DynixNetwork Computing DevicesValid
Dynix Automated Library Systemsnetwork databasevalidation
dynnerNetwork Definition Languagevalue
DYSACNetwork Device Interface SpecificationValue Added Network
DYSTALnetwork engineervalue added reseller
dzNetwork extensible Window Systemvalue added retailer
ENetwork File Systemvalve
E1Network Filing Systemvampire tap
E2Network Information CenterVAN
E2ESNetwork Information Servicevanilla
E3Network Information Systemvanity domain
E4networkingvannevar
E5network interface cardVannevar Bush
E-acutenetwork interface controllervaporware
EAFnetwork layervapourware
EAGnetwork layer reachability informationVAR
eager evaluationnetwork managementvar
Eaglenetwork meltdownvarchar
EAINetwork News Transfer Protocolvariable
EAPROMnetwork nodeVariational Graphics eXtended
earliest deadline firstNetwork Node InterfaceVAX
Early PL/Inetwork numberVAX DOCUMENT
EARNNetwork Operating SystemVAXectomy
EAROMnetwork operating systemVAXen
earthquakeNetwork Operations Centervaxherd
Easenetwork operatorvaxism
EASE IInetwork redirectorVAX MIPS
EASIACnetwork segmentvaxocentrism
EASTNetwork Solutions, Inc.VAXset
easter eggnetwork stormVAXstation
Easter eggingNetwork TerminationVAX/VMS
Eastern Washington Universitynetwork, theVB
EASY FOXNetwork Time ProtocolVBA
eat flaming deathnetwork topologyvbell
eating one's own dogfoodnetwork transparencyVBScript
eating your own dogfoodNetXvbx
EAXNet:Xvc
EBASICneural netsVCC filtering
EBCDICneural networkVCD
EBCIDICneuronVCID
EBNFNeutral InterconnectVCL
EboneneutrosophicVCODE
ecneutrosophic logicVCPI
EC++neutrosophic probabilityVCR
ECAP IIneutrosophic setvdiff
E-carrier systemneutrosophic statisticsVDL
EcashNeutrosophyVDM
ECCNever OfflineVDM++
Eccles-Jordan circuitnewbieVDM-SL
EchidnaNew FlavorsVDSL
echonewgroup warsVDT
echo cancellationNew JerseyVDU
ECHTnewlinevdx
ECIP2NEWPve
ECISNEW Programming languagevector
Eckert-Mauchly Computer CorporationNeWSVector C
ECLnewsvector font
ECLIPSENewsClipvector graphics
ECMnewsfroupvector processor
ECMAnewsgroupvector space
ECMA InternationalnewsletterVECTRAN
ECMAScriptNewspeakVEE
Ecole Normale SuperieureNewsqueakveeblefeetzer
e-commerce.newsrcveeblefester
Econetnews readerveeblefetzer
ECOOPNew Storage SystemVEL
ECPnew talkVendor Independent Messaging
ECRCNew Testamentventilator card
ECRC-PrologNewtonVentura Publisher
ECSLNewton-Raphson iterationVenus flytrap
ECSPNewton's methodverbage
ECSS IINewWaveverbiage
ECSSLNewYaccVerdi
edNew York State Educational Reasearch ETworkverification
EDANew York UniversityVerilog
EDACNEXORVerilog SA
e-ddressNexpert ObjectVeronica
EdenNeXT, Inc.Versa Module Europa
Eden Programming LanguageNext Program Counterversion
EDFNEXTSTEPVersion 7
EDInfvertical application
EDI analystNFAvertical bar
EDIFNFQLvertical encoding
EDIFACTNFSvertical loop combination
Edinburgh Multi Access SystemNFTvertical microcode
Edinburgh PrologngVertical Redundancy Check
Edinburgh SMLNGLvertical refresh rate
EdisonNHOHvertical scan rate
editniVery Efficient Speculative Parallel Architecture
editorNIALVery high bit-rate Digital Subscriber Line
EDLNIAL Systems Ltd.Very Large Database
EDMNIAMVery Large Memory
EdMLnibbleVery Large Scale Integration
EDMSNibble Mode DRAMVery Long Instruction Word
EDO DRAMNICVery Small Aperture Terminal
EDO memoryNIC.DDN.MILVESA
EDO RAMNICEVESA Local Bus
EDPnickVESPA
EDP auditornickleV.FAST
EDRAMNICOL IVFAT
EDSNIFOCV.FC
EDS+Nightmare File Systemvg
EDSACnight modeVGA
eduNIHVGQF
education contactNIHCLvgrep
edutainmentNIIVGX
Edward LorenzNIKLVHDL
Edward YourdonNiklaus WirthVHE
EdwinNILVHLL
eeniladicvhost
EEMANinety-Ninety RuleVHS
EEPROMNintendovi
EERNIOSVIC-20
E. F. Coddnipplevictim cache
EFFNISvideo
effective computableNISOvideo adapter
effective number of bitsNISSvideo card
Effort Adjustment FactorNISTVideo Compact Disc
EFINJCLvideo compression
EFLnlvideo conference
EFNetNLANRvideo conferencing
EforthNLMvideo dial tone
E-ForthNLPvideo display standard
EFTNLRIvideo display terminal
EFTPOSNLSVideo Electronics Standards Association
EFTSNLSPVideo Graphics Adapter
egNLXVideo Graphics Adaptor
EGANMIVideo Graphics Array
EggdropnMLvideo memory
egosurfingNMUVideo on Demand
EGPNNvideo RAM
egrepnnvideo random-access memory
Egyptian bracketsNNIvideo terminal
EhNNTPvideotex
ehnoVienna Definition Language
eHelp CorporationNOCVienna Definition Method
EHTSNODALVienna Development Method
EIANodal Switching SystemVienna Development Method Specification Language
EIA-232noddyVienna Fortran
EIA-232CnodeVietnamese
EIA-422noiseviewer
EIA-423noise marginViewPoints
EIA-449noise shapingViews
EIA-485NOLVIF
EIA-530NOMADVi Improved
EIDENOMEX underwearVIM
EiffelNominal SemidestructorVincennes LISP
Eiffel source checkernon-algorithmic procedurevines
eigenvaluenon-constructive proofVine Technology
eigenvectornondeterminismVint Cerf
eight-bit cleannondeterministicVinton Cerf
eight queens problemnondeterministic automatonViola
eight queens puzzlenondeterministic polynomial timevirgin
eighty-column mindNondeterministic Turing Machinevirgule
eighty-twenty rulenon-impact printerViron
EIRPnon-interlacedvirtual
EISAnonintrusive testingvirtual 86 mode
EJBnonlinearvirtual address
Eksi SozlukNon-Maintainer Uploadvirtual cache
EL1Non-Maskable Interruptvirtual circuit
el(alpha)non-optimal solutionVirtual Circuit Identifier
ElanNonpareilvirtual connection
El Camino Bignumnon parityVirtual Control Program Interface
elder daysnon-polynomialVirtual Device Driver
e-learningNon Return to Zero InvertedVirtual Device Location
Electing a Popenontrivialvirtual disk
Electrically Alterable Programmable Read-Only MemoryNon-Uniform Memory AccessVirtual Home Environment
Electrically Erasable Programmable Read-Only Memorynon-uniform quantising logarithmic compressionvirtual host
Electromagnetic CompatibilityNon-Uniform Rational B SplineVirtual LAN
electromigrationnon-volatileVirtual Loadable Module
electronnon-volatile memoryVirtual Local Area Network
electronic commerceNon-Volatile Random Access MemoryVirtual Machine
Electronic Commerce Dictionarynon-volatile storagevirtual machine
electronic data interchangenoobVirtual Machine/Conversational Monitor System
Electronic Data Processingno-opVirtual Machine Environment
Electronic Design AutomationNORVirtual Machine/ESA
Electronic Discrete Sequential Automatic ComputerNORC COMPILERVirtual Machine/System Product
Electronic Frontier FoundationNorCroftVirtual Machine/XA
electronic funds transferNORD PLvirtual memory
Electronic Funds Transfer Point of SaleNORDUnetVirtual Memory System
electronic funds transfer systemnormvirtual path
electronic magazinenormal distributionvirtual point of presence
electronic mailnormal formvirtual PoP
electronic mail addressnormalisationVirtual Private Network
electronic mail clientnormalisedvirtual reality
electronic meetingnormal order reductionVirtual Reality Modeling Language
Electronic Numerical Integrator and Computernormed spaceVirtual Sequential Access Method
Electronic Performance Support Systemnorthbridgevirtual server
Electronic Piece Of CheeseNorthWestNetvirtual shredder
Electronic Report ManagementNOSVirtual Software Factory
Electronics Industry AssociationNOTVirtual Storage Access Method
electronic whiteboardingNot-a-NumberVirtual Storage Extended
electron modelnotebookVirtual Telecommunications Access Method
electron tubeNoteCardsvirus
Electrostatic DischargeNotepadviruses
elegantNotesvisible bell
elementNotherVisiCalc /vi'zi-calk/
elephantnot ready for prime timevisionary
elephantinenotspotvisit
elevator controllernotworkVisual BASIC
ELFNovaVisual Basic for Applications
ELINovell Data SystemsVisual BASIC Script
Eli Compiler Construction SystemNovell DOSvisual bell
ELISPNovell, Inc.Visual C++
eliteNovell NetWareVisual Component Library
ELIZANOWEBVisual dBASE
ELIZA effectno-write allocationVisual Display Unit
ElkNPVisual FoxPro
ELLAnpVisual Interface
EllemtelNPCvisualisation
EllieNP-completevisual language
ELLISNP-hardvisual programming
elmNP-hilariousvisual programming environment
ELMAGUIDENPLvisual programming language
ELMAMETANPPLVisualWorks
ELPN-PrologVITAL
ELSIENP timeVIVID
ElvisNP trickyviz
elvishNQSVLAN
EMNqthmVLB
EM-1nrVLDB
EMANRENVlisp
EmacsnroffVLIW
Emacs LispNRZVLM
e-mailNRZIVLSI
e-mail addressnsVLSM
e-mail clientNS16000VM
EMASNS32000VM/CMS
Embedded Lisp InterpreterNSA line eaterVME
Embedded ModeNSAPIVMEbus
embedded systemNSDIVME Microsystems International Corporation
embeddingNSEVM/ESA
EMBLA ProNSFVML
embosserNSFIPVMS
EMCNSFNETVM/SP
EMD Enterprises, Inc.NSIVM/XA
EMDIRnslookupvn
EmeraldNSRDvocoder
EMINSSvocoding
Emitter Coupled LogicNTVoD
EMLNT1voice mail
EMMNT5voice-net
EMM386ntalkVoice over IP
emoteNTASvoice recognition
emoticonNT File SystemVoIP
empegNTFSvolatile
empiren-tiervolatile memory
empty element tagNTISvolatile storage
EMSNTMBSvolatile variable
emTeXNTPvoltage
EMU8000NTSCVolume Table Of Contents
emulationNTUvon Neumann architecture
emulatornuvon Neumann integer
Emulator programNuBusvon Neumann, John
EMXnu-calculusvon Neumann machine
enablingNUCLEOLvon Neumann ordinal
Encapsulated PostScriptnudevoodoo programming
encapsulationnukeVoronoi diagram
encodenullVoronoi polygon
encodernullaryVOS
encryptionnull modemVoters Telecommunications Watch
endiannull-terminated multibyte stringvoxel
endless loopNUMAV.pcm
End Of LineNumber 5 Electronic Switching SystemVPL
End of Mediumnumber crunchingVPN
End Of Textnumber keysVP-Planner
End Of TransmissionnumbersVQF
end tagnumber signVR
end-to-end solutionnumeric keypadVRAM
End Transmission BlockNumerisVRC
end-userNuprlVrije Universiteit, Amsterdam
engageNU-PrologVRML
Engelbart, DouglasnurbsVRTX
engineNu ThenaVSAM
EnglishNUXI problemVSAT
English shellcodeNVLVSCM
Enhanced Capabilities PortNVRAMVSE
Enhanced Directory ServiceNVSV series
Enhanced Dynamic Random Access MemoryNWNETVSF
Enhanced Graphics AdapterNYAPVSP
Enhanced IDEnybbleVSTa
Enhanced Integrated Drive ElectronicsnyetworkVSX
enhanced parallel portnymVT
Enhanced Small Disk Interfacenym servervt100
enhancementNyquist frequencyvt220
ENIACNyquist TheoremVTAM
EnigmaNYSERNETVTC
ENOBNYU OMNIFAXVTOC
ENQnzVTS
enqueueOVTW
ENSO2vu
Ente Nazionale Italiano di UnificazioneOaklispVUE
enterpriseOAPVUIT
Enterprise Application IntegrationOASIS Open Document Format for Office ApplicationsVULCAN
Enterprise JavaBeansOATHVulcan death grip
Enterprise Report ManagementOb-Vulcan nerve pinch
Enterprise Resource PlanningOBDCvulnerability
Enterprise Systems CONnectivityOBEvulture capitalist
EntireXOberonVUP
entityOberon-2VxD
entity-relationship diagramOberon-VVXI
entity-relationship modelOBEXVxWorks
entropyobfuscatedW2K
Entry Sequenced Data SetObfuscated C ContestW3
enumerated typeobi-wan errorW3C
enumerationOBJW3 Consortium
environmentOBJ0WA-12
Environmental Audio eXtensionsOBJ2wabbit
environment variableOBJ3Wabi
EnvoyobjectWabiServer
EOFObjectBrokerwacco
EOLObjectCenterWafe
EORObject CHILLWAFL
EOTobject codeWAIS
EOUObject-code Buffer Overrun EvaluatorWAITS
EOUGObject Compatibility Standardwait state
EPObject Constraint Languagewaldo
EPCSObject Database Management Groupwalk
ephemeral portObject Data Management Groupwalking drives
EPILOGObjecteeringwalk off the end of
EPIMObject Exchangewall
EPLobjectfuscated codewall clock time
EPOCobject identifierwall follower
epochObjectionable-Cwallpaper
EPPObjective Cwall plate
EPROMObjective CAMLwall time
EPROM OTPObjective Modula-2WAM
EPROSObjective PASCALWAN
EPSObject Linking and EmbeddingWang Laboratories
EPSILONObject Lispwango
epsilonObjectLOGOWang PC
epsilon squaredObject Management Groupwank
EPSIMONEObject management systemwannabee
EPSSobject methodwant list
EqLObject Modelling TechniqueWAP
EQLOGObject OberonWAP Forum
EQLogobject-orientationwarchalk
Eqnobject-orientedWard Christensen
equalsobject-oriented analysisWard Cunnigham
equational logicobject-oriented databasewardialer
Equational Programming Languageobject-oriented designwardriving
EquelObject-Oriented Fortran-ware
equivalence classobject-oriented languagewarez
equivalence class partitioningObject-Oriented PascalWarGames
equivalence partitioningobject-oriented polymorphismwarlording
equivalence relationobject-oriented programmingwarm boot
equivalent isotropically radiated powerobject-oriented programming languageWarm Silence Software
ERObject-oriented SQLWarp
erObject-Oriented Turingwart
ERAObjectorywashing machine
eraObjectPALWasserman
Erasable Programmable Read-Only MemoryObject PascalWATBOL
eraseObject Persistence FrameworkWatcom C/C++
eraser stains codeObject Request BrokerWatcom International
ERCObject Role ModelingWatcom SQL
ERCIMObject ValueWatcom VX*REXX
ERDObjectworksWaterfall Model
EREW PRAMObject Zwater MIPS
ERFPIObjlogWATFIV
ergonomicOBJTWATFOR
ergonomicsObjVlispwav
ERGO-ShellObjVPrologWAVE
Eric ConspiracyObliqwave a dead chicken
Eric S. Raymondoblique strokewave division multiplexing
ErisOblogWaveform Generation Language
ErlangOBOEwavelength division multiplexing
ERMOBSCUREwavelet
eroticaobservational equivalencewavetable
ERPOcwavetable synthesis
errorOC-12WaZOO
error-based testingOC-3wb
error correcting memoryOC-48WBEM
error detection and correctionOCALWBMP
esoccamWBS
ES-1occam 2WCDMA
ESAOccam's RazorWCL
ESCoccludeWD
ESCAPEoccurs checkWDASM
escapeOCLWDM
escape sequenceOCLCWE
ESCDOC-nWeak Head Normal Form
ESCONOCODEweakly typed
escrowOCPweak typing
ESDOCRweasel
ESDIOCSWEB
ESFoctalWeb
ESIoctal fortyWeb 2.0
esimOctaveweb2c
ESLoctetweb address
ESLPDPROoctothorpeweb authoring
ESMLOCXWeb-Based Enterprise Management
ESMTPOD390web browser
ESPODAwebcam
ESPOLODBCwebcasting
ESPRITODCWebCGM
ESROdeWebCOMAL
essential complexityODIweb cramming
EstelleODIFWebCrawler
EsterelODMAwebhead
EstPCODMGweb host
ETodometryweb hosting
etODPweblint
ET++ODSweb log
eta abstractionODSAweb mail
eta conversionODTwebmaster
eta expansionOEMwebmistress
eta reductionOFAwebmonkey
ETBoff-by-one errorWebObjects
ETCOfficeweb page
e-textoffice automationweb proxy
ETHEROffice By ExampleWeb Request Broker
EtherGateOffice Workstations Limitedweb server
EthernetOfficial Production SystemWeb Service Definition Language
Ethernet addressoff-lineWeb Services
Ethernet meltdownoff-line worldWeb Services Business Process Execution Language
Ethernet Private Lineoffsetwebsite
EtherTalkoffshoringweb smith
ethicsoff-side ruleWebster
ETLoff the trolleyWebster's Dictionary
ETMoggwedged
ETRNOgg Vorbiswedgie
ETSIOHCIwedgitude
ETXOhmWeeble
EuclidOhm, Georg Simonweeds
Euclidean Algorithmohnosecondweenie
Euclidean normOICWeenix
Euclid's AlgorithmOIDweighted search
Eudora-oidwell-behaved
EULAOILwell-connected
EULEROLAPwell-known port
EuLispOLAP Councilwell-ordered set
EUnet Ltd.OLCWEP
EuphoriaOLDASWesley Clark
Eurekaold fartWestern Digital Corporation
Eureka stepold talkWestmount
EuriskoOld Testamentwetware
EurocardOLEwf
Euro-ISDNOLE custom controlsWFL
EuroNetOLE DBWfMC
EuropaNETOLE for Process ControlWFW
European Academic and Research NetworkOLGAWFWG
European Computer-Industry Research Centre GmbHOlivettiWG
European Computer Manufacturers AssociationO-LogicWGL
European Strategic Programme for Research in Information TechnologyOLTPwhack
European Telecommunications Standards InstituteOLWMwhacker
EUUGomwhales
EV6OMAwhalesong
EvaOmegawhatis
EVALUATEOmega-algebraicWhat's a spline?
evaluationOmega testWhat You Get Is What You Never Thought You Had
evaluation strategyOMFWhat You See Is All You Get
evaluatorOMGWhat You See Is What You Get
EVEOMNICODEwheel
eventOMNIFAXwheel bit
Event Description LanguageOMNITABwheel wars
event-drivenOMRWhen It's Done
EVGAOMSWhetstone
evolutionary algorithmOMTWhich Stands For Nothing
evolutionary computationOMToolwhile
evolutionary programmingONCwhile loop
evolution strategyOndineWhirlwind
EWOSoneWhite Book
exa-one-banana problemWhite book CD-ROM
Exabyteone-dimensional arraywhite box testing
exabyteone-line fixWhite pages
examining the entrailsone-liner warswhite paper
EXAPTones complementwhite point
Excalibur bugOne-Time Passwordwhitespace
ExceedOne Time Programmable Read-Only Memorywhite trash
Excelone-way functionWHNF
Excelanone-way hash functionwhois
Exceleratoron-linewhole number
exceptionOn-Line Analytical ProcessingWhopper
exception handlerOnline Computer Library Center, Inc.WHQL
EXCHOn-Line Computer systemWIBNI
Exchange ServerOnline MediaWIC
exclOn-line Process SynthesizerWide Area Information Servers
exclamation markOnline Public Access CatalogWide Area Network
exclamation pointOn-Line Transaction ProcessingWide Area Telecommunications Service
exclusive orOnticWideband ATM
EXCPontoWide SCSI
EXEontologywidget
EXECOnXwi-fi
execOOWi-Fi Protected Access
EXEC 2OOAWi-Fi Protected Access Pre-Shared Key
EXEC 8OODwiggles
executableOODBwiki
executable contentOODBMSWiLAN
executeOOFWild_LIFE
Execute Channel ProgramOOGLwild card
executionOOoWilf Hey
executiveOOPWilliam Gibson
Executive Systems Programming Oriented LanguageOOPLWilliam Hamilton
exercise, left as anOOPSWilliam Joy
exhaustive testingOOPSLAWIMP
existence proofOOSDWIMP environment
existential quantifierOOZEwin
exitopWin2K
EXODUSOPACWin32
eXodusOpalWin32s
EXOSOPCWin 95
expanded memoryop codeWin 98
expanded memory manageropenwinchester
expanded memory page frameopen box testingwindowing
Expanded Memory SpecificationOpenBSDwindowing system
expansion cardopen/closed principlewindow manager
expansion slotopen-collar workerWindow RAM
expectOpen DataBase ConnectivityWindow Random Access Memory
eXperimental LISPOpen Data-link InterfaceWindows
Experimental Physics Control SystemsOpen DeathTrapWindows 1
Experimental Programming LanguageOpen DesktopWindows 2
Experiment Description LanguageOpen Distributed ProcessingWindows 2000
Expert Judgement ModelsOpen Distributed System ArchitectureWindows/286
expert systemOpenDocWindows 2K
Expert Systems Ltd.OpenDocumentWindows 3.0
explicit parallelismOpen Document ArchitectureWindows 3.1
explicit type conversionOpen Document Interchange FormatWindows 3.11
exploitOpen Document Management APIWindows/386
Exploratory Data AnalysisOpenGLWindows 4GL
exponentOpen Graphics LibraryWindows 94
exponentialOpen GroupWindows 95
exponential-timeOpenInsightWindows 98
exponential-time algorithmOpen LookWindows 9X
ExpressOpen Network ComputingWindows Application Binary Interface
expressionOpenOffice.orgWindows CE
expression treeOpen PrologWindows for Workgroups
extendOpen Scripting ArchitectureWindows Hardware Quality Labs
Extended Affix GrammarOpen Shortest-Path Firstwindow shopping
Extended ALGOLOpen Shortest-Path First Interior Gateway ProtocolWindows Internet Naming Service
Extended ArchitectureOpen Software FoundationWindows Management Interface
Extended Backus-Naur Formopen sourceWindows ME
Extended Binary Coded Decimal Interchange CodeOpen Source DefinitionWindows Messaging
Extended BNFOpen Source Initiativewindows messaging
Extended C++Open source licenseWindows Millennium Edition
Extended Capabilities PortOpenStepWindows NT
Extended Concurrent Prologopen switchWindows NT 3.1
Extended Data Out Dynamic Random Access MemoryOpen System ArchitectureWindows NT 3.5
Extended Data Out Random Access MemoryOpen Systems InterconnectWindows NT 4
Extended Fortran LanguageOpen Systems InterconnectionWindows NT 5
eXtended Graphics ArrayOpen Telecom PlatformWindows NT Network Model
Extended Industry-Standard ArchitectureOpen Trading ProtocolWindows Open Service Architecture
extended memoryOpenTransportWindows Registry
extended memory managerOpen UniversityWindows sockets
Extended Memory SpecificationOpenVMSWindows XP
Extended MLOpenWindowsWindows XP Pro
Extended PascaloperandWindows XP Professional Edition
Extended Self-containing Prologoperating systemwindow system
Extended System Configuration DataOperating System/360Windoze
Extended Systems Modelling LanguageOperating System/Multiprogramming of Fixed TasksWind River Systems
Extended Tcloperational databasewinged comments
Extended TinyOperational Data Storewinkey
Extended Video Graphics Arrayoperational requirementsWinMaker Pro
eXtended Video Graphics Arrayoperational semanticsWINS
ExTendible Compileroperational test and evaluationWinsock
extensibleoperational testingWinSoft Products Ltd
extensible databaseoperation codewintel
Extensible Firmware Interfaceoperations support technicianWINZIP
Extensible HyperText Markup Languageoperatorwired
Extensible Markup LanguageOperator Control Languagewirehead
Extensible Shelloperator overloadingwireless
Extensible Stylesheet LanguageOPFWireless Application Protocol
Extensible Stylesheet Language TransformationsOpportunity Management Systemwireless bitmap
Extensible VAX EditorOPSwireless hotspot
extensionOPS5wireless local area network
extensionalOPS83Wireless Local Loop
extensional equalityOptical Carrier 12Wireless Transport Layer Security
extensionalityOptical Carrier 3wirewater
Extension Language KitOptical Carrier 48WISCII
Exterior Gateway ProtocolOptical Carrier nwish list
eXternal Data RepresentationOptical Character RecognitionWisp
External Machine Interfaceoptical diffwithin delta of
external memoryoptical disc drivewithin epsilon of
EXTRAoptical disk drivewizard
extranetoptical driveWizard Book
extrapolateoptical fiberwizardly
extrapolationoptical fibrewizard mode
EXUGoptical grepWizDOM
eyeball searchOptical Mark Readerwk1
EZoptical mouseWLAN
ezdoptical storageWLL
e-zineOptical Storage Technology AssociationWMA
F100-LOptical Time Domain Reflectometerwmf
f2cOptical Time Domain ReflectometryWMI
F2FoptimalWML
F68KOptimal Flexible ArchitectureWMV
FACoptimiseWNPP
facebook.comoptimising compilerWO
face timeoptimismWolfram Research, Inc.
face-to-faceoptimizeWOM
Facileoptionwoman
facsimileOPTRANWOMBAT
FACTOpuswombat
factORwombat.doc.ic.ac.uk
factorOracleWoodenman
factorialOracle 7woofer
FADOracle CardWOOL
failbackOracle*CASEWorcester Polytechnic Institute
failoverOracle Co-operative ApplicationsWord
failureOracle Corporationword
failure-directed testingOracle Parallel ServerWord for Windows
FAIROracle RdbWordNet
Fairchild F8Oracle ToolkitWordPerfect
fall backOrange BookWordPerfect Corporation
fall forwardORBword processing
fall overOrbitword processor
fall throughOrcaword size
fall thruOrder Code Processorword spamming
FALSEorder-embeddingWordTech
fandango on coreorderingword wrap
fan-outordinalworkaround
FAPordinary differential equationWork Breakdown Structure
FAQordinateworkflow
FAQLOREGANOWorkflow Management Coalition
FAQ listO'Reilly and Associatesworkgroup
faradiseorgworking as designed
farkledOrganic Modeworking memory
farmOrient84/Kworking set
farmingOriginal Equipment Manufacturerworking set model
FARNETORKIDWork Needed and Prospective Packages
fasORMwork path
FASBOLorphaned i-nodeworksheet
fascistorphan processworkstation
FASEORTHOCARTANWorld Time
FASTorthogonalWorld-Wide Wait
Fast ATAorthogonal instruction setWorld-Wide Web
Fast ATA-2OrwellWorld Wide Web Consortium
Faster LEXOSWorld Wide Web Worm
Fast EthernetOS2WORM
Fast Fourier TransformOS/2worm
Fast PacketOS/360wormhole
Fast Page Mode Dynamic Random Access MemoryOS/390wormhole routing
Fast SCSIOS-9WOSA
FATOSAWOSA Extensions for Financial Systems
FAT32OSA extensionWOSA/XFS
fatalOSAXwound around the axle
fatal errorOsborne 1WPA
fatal exceptionOsborne, AdamWPA Pre-Shared Key
fat binaryOsborne Computer CorporationWPA-PSK
fat clientOSCARWPG
fat electronsOSDWPI
faultOSEWPL+
fault-based testingOSFWPOP
fault toleranceOSIwps
fault tolerantOSI ModelWRAM
fault tree analysisOSI Reference Modelwrap around
faxOSI-RMwrapper
Fax over IPOSI seven layer modelwrats nest
FCO'smallwrb
FC-ALOS/MFTwrite
FCBOS/MVTWRITEACOURSE
F-codeOSPwrite-back
FCPOSPFwrite buffer
FC-PGAOSQLWrite-Once Read-Many
FCSOSSLwrite-only code
FDCOSTAwrite-only language
FDDOS/VS1write-only memory
FDDIOS/VS2write protect
FDISKOTwrite-through
fd leakOTDRwrite-thru
fdlibmOT&Ewriting system
FDMAOTIWrong Thing
FDSEOTOHWRT
FDSPOTPws
FDTOTPROMWSBPEL
fdxOTTWSDL
FEAOttawa EuclidWSFN
fear and loathingOusterhout, John K.WSL
fear-driven developmentOusterhout's dichotomyWTF
feasibility studyOusterhout's fallacyWTFPL
feasibleOusterhout's false dichotomyWTH
featureoutWTLS
feature creatureouter joinWumpus
feature creepoutline fontWWW
featurectomyout-of-bandWWW browser
feature keyoutputWWWW
feature shockoutput deviceWYGIWYNTYH
FECOutside Awareness PortWYSIAYG
FEDoutside-in testingWYSIWYG
Federal Geographic Data CommitteeoutsourcingWYSWYG
Federal Information ExchangeoverclockingX
Federal Information Processing StandardsOverdriveX-1
Federal Networking CounciloverflowX11R4
federationoverflow bitX11R5
Federation Against Software Theft Limitedoverflow flagX11R6
Fedoraoverflow pdlX.12
feedoverheadX2
feedbackoverloadingX.208
feedback controloverridingX.209
feed-forwardoverrunX.21
Feeloverrun screwX.214
feepoveruse strain injuryX.215
feeperOWHYX.216
feeping creatureOWLX.217
feeping creaturismOwlX.219
FELOxX.224
femto-OzX.225
fenceozX.226
fencepost errorOz-EmailX.227
fepped outP+X.229
FEPROMP1754X.25
Fermat primep2cX.28
Fermat's Last PostP2PX.29
Ferranti F100-LP3LX.3
ferrite core memoryP4X3J16
Ferroelectric RAMP6X3T10
Ferroelectric Random Access MemorypaX.400
FetchPABXX.409
fetch-execute cyclePACEX.500
Feynman, Richard P.Packard Bell Electronics, Inc.X.680
FFpacked decimalX.75
ffcccPacked Encoding Rulesx86
FFPpacketx86 processor socket
FFTPacket Assembler/DisassemblerXA
FGDCpacket driverXaw
FGHCPacket in Plastic Grid ArrayXbase
FGLPacket InterNet Groperxbeeb
FGL+LVpacket radioxbm
FGRAALpacket snifferXC
fgreppacket switchX client
FhGpacket-switchedX Consortium
FHSpacket switchingXcoral
FHSSPacket Switch Nodexdbx
fipacket writingX-Designer
Fiber Distributed Data InterfacePackItX.desktop
Fiber Optic InterRepeater LinkPACT IXDL
fiber opticsPACTOLUSXDR
Fibonacci sequencePADXDS 530
Fibre Channelpadded cellXDS 940
Fibre Channel-Arbitrated LoopPaddlexDSL
fibre opticsPAGEXemacs
FIDILpageXENIX
FIDOpagedXeon
FidoNetPage Description Languagexerox
fieldPaged Memory Management UnitXEROX Corporation
field circuspage faultXerox Data Systems Model 530
field effect transistorpage inXerox Data Systems Model 940
field emission displaypageletXEROX Network Services
field mousepage modeXerox Network System
field-programmable gate arrayPage Mode DRAMXEROX PARC
field servoidPage Mode Dynamic Random Access MemoryXerox Star
FIFOpage outXFree86 Project, Inc.
FifthpagerXFS
Fifth Dimension TechnologiespagingXfun
fifth generation languagePaiLispXGA
fifth normal formpain in the netXGA-2
Fight-o-netPaintbrushXHTML
filePAISleyXi
File Allocation TablePajekXIE
File AttachPALXilinx, Inc.
File CompositionPalaceXilinx Netlist Format
file compressionpaletteX Image Extension
file control blockpalmtopXlib
file descriptorPalo Alto Research Centerxlisp
file descriptor leakPalo Alto Research Centrexls
file extensionPAMXML
FileMakerPamXML schema
FileMaker, Inc.PandoraXML Template Pages
filename extensionpanicXML User-Interface Language
FileNetPANONXMM
File RequestPANSXMODEM
File SeparatorPansophicXMODEM-1K
file serverPantonexmosaic
File Service ProtocolPAPXMS
file signaturePaper Feed Control CharacterXNF
file systempapermailxnf2ver
Filesystem Hierarchy Standardpaper-netXNS
file transferpaper tapeXOFF
File Transfer Protocolparaconsistent probabilityXON
file typePARADEXON/XOFF
filing systemPARADIGM PLUSXopen
filkParadigms of AI ProgrammingX/Open
fill-out formParadiseX/open Portability Guide
film at 11ParadoxX/Open System Interface
FILOparadoxxor
FiltabyteParadox Application LanguageXP
filterParagonXPC
filter promotionParalationXperCASE
FIMSParalation CXPG
Finagle's LawParalation LISPXPG3
Financial Information eXchangeParAlflXPL
FinderParallaxisxpm
fine adjusterparallelXPOP
fine grainParallel Advanced Technology AttachmentXP Pro
fingerParallel ATAXpress Transport Protocol
finger-pointing syndromeParallel CX protocol
finiteparallel computerxref
Finite Automataparallel computingXRemote
Finite AutomatonParallel FORTHXRN
finite differencingParallel FortranXSB
Finite Impulse ResponseParallel HaskellXScheme
Finite State Automataparallelismx-scm
Finite State AutomatonParallel PascalXSD
Finite State Machineparallel portX server
finnParallel Presence DetectXSI
FIPSparallel processingXSL
FIRparallel processorXSLT
firebottleparallel random-access machineXT
firefightingparallel reductionXt
FirefoxParallel Server OptionXT bus architecture
firehose syndromeParallel SMLxterm
firewallParallel SysplexX terminal
firewall codeParallel Virtual MachineXTI
firewall machineparamXTP
FireWireparameterXTP Forum
fireworks modeparameter RAMXTRAN
Firmwareparametric polymorphismXUI
firmyparaMLXUL
first class moduleparanoid programmingXv++
First FitParaSoft CorpXVGA
first generationParasolXView
first generation computerPARCXVT
first generation languageParcPlace SystemsX-Windows
first-in first-outparentX Window System
first normal formparenthesesXWIP
first-orderparent messagexxgdb
first-order logicparent processXXX
First Party DMAPariXy-pic
fishParisxyzzy
FISH queueparityY
FITNRparity bitY2K
FITSparity errorYA-
FIXParkinson's Law of DataYaa
fixPark-MillerYABA
fixed diskParlanceyacc
fixed pointParlogYADE
fixed-pointParlog++YAFIYGI
fixed point combinatorparmYAGNI
fixed-radio accessPARMACSYahoo
fixed-widthParModYale Haskell
FIXMEPARSYamaha
fixpointparseYAML
fjPARSECYAML Ain't Markup Language
Fjolnirparseryank
fkparser generatorYAPS
FLparsingYASOS
F+LParsleyYAUN
flagPartial Differential Equation LANguageYay
flag daypartial equivalence relationye
FLAIRpartial evaluationYear 2000
flakypartial functionYellow
flamagepartial keyYellow Book
flamepartially ordered setYellow Book CD-ROM
flame baitpartial orderingYellow Book, Jargon
flame offPartial Response Maximum LikelihoodYellow Box
flame onpartitionYellow Pages
flamerpartitioned data setyellow wire
flame warPARTSYerk
flaming@-partyYet Another
FLAPPARULELYet Another Compiler Compiler
flapPASCYet Another Scheme Object System
flapping routerPascalYet Another Yacc
flarpPascal-YGMTPO
FlashPascal-80YLISP
flashPascal+CSPYMMV
flash drivePascal-FYMODEM
Flash EPROMPascal-FCYMODEM-G
Flash Erasable Programmable Read-Only MemoryPascal/Lyocto-
Flash Lights ImpressivelyPascal-LindaYoda condition
flash memoryPascal-mYOL Computers
Flash ROMPascal-Pyotta-
flatPascal P4yottabyte
flat address spacePascal PlusYou are not expected to understand this
flat ASCIIPascal/RYou aren't gonna need it
flat filePascal-SYourdon
flat file databasePascal-SCYourdon/Constantine
flattenpasos2Yourdon/Demarco
flat thunkPasqualYourdon, Inc.
FlavorsPASROYourdon methodology
FlengPASSIMYour mileage may vary
FLEXpassive matrix displayyoutube.com
FlexpassphraseYouTube, Inc.
Flex++passw0rdYow!
Flex 2passwordyoyo mode
FLIPassword Authentication ProtocolYP
flibpasteYSM
FLICpastieyt
FLIPPATYTalk
Flip Chip Pin Grid ArrayPATAyu
flip-floppatchYu-Shiang Whole Fish
flippypatch pumpkinZ
FLIP-SPURpatch spaceZ++
floatPATCHYZ-1013
floaterpathZ180
floating-pointpath coverage testingZ3
floating-point acceleratorpathnameZ39.50
Floating-Point SPECbaseratepathname separatorZ8
Floating-Point SPECbaseratiopathologicalZ80
Floating-Point SPECratePath PascalZ8000
Floating-Point SPECratiopathspecza
floating point underflowpattern matchingZAP
Floating-Point Unitpattern recognitionzap
floating underflowPAWZAPP
F-LogicPAW++Z-buffer
floodpaywareZEBRA
FLOPPB CacheZed
FloppyPBCAKZen
floppyPBDzen
floppy discPBEMZENO
floppy diskPBKACzepto
floppy disk drivePBMZermelo Fränkel set theory
floppy drivePBXZermelo set theory
FLOPSPCZERO
FlopspC++zero
flopticalPC-1834Zero and Add Packed
FlowPC200zero assignment
flow chartPC-7150zero-content
flow controlPCAZero Insertion Force
flower keyP-CADzeroth
FLOW-MATIC or FLOWMATICPC ATZEST
flow of controlPCBZetaLisp
FLPLPC Cardzetta-
FLUBPCCTSzettabyte
Fluegelman, AndrewPCFZeus
flushPCIZFC
Flynn's taxonomyPCI busZF expression
fly pagePCI Configuration UtilityZIF
Flyspeck 3PCI Mezzanine Cardzigamorph
flytrapPCI slotZIL
FMPC-ismZilog
fmPCjrZilog Z280
FMPLPCLZilog Z8
FMQPCLIPSZilog Z80
FMSPCMZilog Z8000
FMVPCMCIAZilog Z80000
FNALPCMIAZilog Z80A
FNCPCNzip
fnordPC-NFSZipcode
FN tunnellingP-codeZip disc
foPC PursuitZip disk
FOADPC-RTZip Drive
FOAFPCSzip file
FOCALPC-Schemezip function
FOCLPCS/Genevazipped
FOCUSPC supportzipped file
focus groupPC-TALK IIIzipperhead
FODPCTEzm
FOILPCTE+ZMODEM
FoIPPC-TILESZOG
FOIRLPCUZOLA Technologies
fold casePC-warezombie
folderpcxzombie process
FOLDOCPDzone
followupPDAZoo
fontPDCzoo
fontologyPDC Prologzoom
fooPDELZoomer
foobarPDELANZOPL
foogolPDESzorch
FOOLPDFZork
fool filePDFTeXzorkmid
Fools' LispPDHz/OS
FoonlyPDILzr
FOOPpdkshzsh
foot-netPDLZ shell
footprintPDL2ZUG
forPDMZulu time
foraPDPZUSE
FORCPDP-10Zuse
ForcePDP-11Zuse, Konrad
ForceOnePDP-20zw
ForceTwoPDP-6ZX-80
foregroundPDP-7ZX-81
Foreign eXchange OfficePDP Assembly Languagezxnrbl
Foreign eXchange SubscriberPDSZX Spectrum
foreign keyPDSA cycleZynet Ltd.
ForesightPDS/MaGenZyXEL
for freePDU|
forkPE~
fork bombpe£
forkedPeaceNet 
for looppeak envelope power 


Loading